DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Bhlhe23

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_542372.2 Gene:Bhlhe23 / 140489 MGIID:2153710 Length:223 Species:Mus musculus


Alignment Length:122 Identity:36/122 - (29%)
Similarity:46/122 - (37%) Gaps:41/122 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RNTANKKERRRTQSINNAFSYLREKIP--NVPTDTKLSKIKTLKLAILYINYLVNVLD------- 115
            |.:.|.:||||...:|:|...||..||  :.|:..|||||.||.||..||......|:       
Mouse   100 RLSINARERRRMHDLNDALDGLRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALEEMRRLVA 164

  Fly   116 --------------GDLDPKGGFRAELKPVSRKI----CSEK------------KHC 142
                          ..|.|.|  :|.:.|.|...    |.:|            |||
Mouse   165 YLNQGQGLAAPVAAAPLTPFG--QAAIYPFSAGTALGPCPDKCATFSGSPSALCKHC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 24/55 (44%)
Bhlhe23NP_542372.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..93
bHLH_TS_bHLHe22_bHLHb5 99..168 CDD:381524 25/67 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.