DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Ferd3l

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_277057.1 Gene:Ferd3l / 114712 MGIID:2150010 Length:168 Species:Mus musculus


Alignment Length:105 Identity:31/105 - (29%)
Similarity:52/105 - (49%) Gaps:15/105 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NMFDMKHSESQVQQQIYN---------------TSHLGYVPTSNTRIVKKRNTANKKERRRTQSI 74
            :.||.::.|.:..:..|.               .|.||...........:|..||.:||:|..::
Mouse    55 SQFDERYQEVEGDEVEYEDPEEEEEEGEGRGRVASLLGRPKRKRVITYAQRQAANIRERKRMFNL 119

  Fly    75 NNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVL 114
            |.||..||.|:|....:.:||:|:||:|||:||:::..:|
Mouse   120 NEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 23/50 (46%)
Ferd3lNP_277057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..88 1/22 (5%)
bHLH domain 104..159 23/54 (43%)
HLH 104..156 CDD:278439 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839683
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.