powered by:
Protein Alignment Hand and tcf24
DIOPT Version :9
Sequence 1: | NP_609370.2 |
Gene: | Hand / 34379 |
FlyBaseID: | FBgn0032209 |
Length: | 174 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004915228.1 |
Gene: | tcf24 / 101732426 |
XenbaseID: | XB-GENE-6465054 |
Length: | 182 |
Species: | Xenopus tropicalis |
Alignment Length: | 49 |
Identity: | 23/49 - (46%) |
Similarity: | 32/49 - (65%) |
Gaps: | 0/49 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 66 KERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVL 114
:||.|.|::.:||..|:..:|:||.||||||:..|.||..||.:|...|
Frog 60 RERNRVQTLRHAFLELQRTLPSVPPDTKLSKLDVLILATTYIAHLTRSL 108
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Hand | NP_609370.2 |
HLH |
59..110 |
CDD:278439 |
21/43 (49%) |
tcf24 | XP_004915228.1 |
bHLH_SF |
<65..108 |
CDD:381792 |
19/42 (45%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1449816at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.