DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and hand2

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001093695.1 Gene:hand2 / 100101704 XenbaseID:XB-GENE-481426 Length:210 Species:Xenopus tropicalis


Alignment Length:137 Identity:77/137 - (56%)
Similarity:89/137 - (64%) Gaps:12/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SHLGYVPTSNT-----RIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLA 103
            ||.|.||.|..     |.||:|.|||:||||||||||:||:.|||.|||||.||||||||||:||
 Frog    73 SHYGGVPGSGAGGLMQRPVKRRGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLA 137

  Fly   104 ILYINYLVNVLDGDLDPKG---GFRAELKPVSRKICSEKK---HCLKSEIQNVPLSTKGRTGWPQ 162
            ..||.||:::|..| |..|   .|:||:|....|....||   ..|||.:.:....|||||||||
 Frog   138 TSYIAYLMDLLAKD-DQNGETEAFKAEIKKTDVKEEKRKKELNELLKSTVCSNDKKTKGRTGWPQ 201

  Fly   163 DVWASEL 169
            .|||.||
 Frog   202 HVWALEL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 38/50 (76%)
hand2NP_001093695.1 bHLH_TS_HAND2 93..154 CDD:381477 43/61 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8501
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I4558
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449816at2759
OrthoFinder 1 1.000 - - FOG0005250
OrthoInspector 1 1.000 - - otm48429
Panther 1 1.100 - - O PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5507
SonicParanoid 1 1.000 - - X3772
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.