DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ufd4 and Smurf1

DIOPT Version :9

Sequence 1:NP_609369.1 Gene:Ufd4 / 34378 FlyBaseID:FBgn0032208 Length:2727 Species:Drosophila melanogaster
Sequence 2:XP_006504947.1 Gene:Smurf1 / 75788 MGIID:1923038 Length:757 Species:Mus musculus


Alignment Length:799 Identity:169/799 - (21%)
Similarity:257/799 - (32%) Gaps:268/799 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1985 DPRPGRTNVNQTSDLEISPLGAELPKPQQ----------SGGPETIEQP-----LLGLKLRGPGI 2034
            |..|||            ||...:.:|..          .|....:|.|     ||..:||.|.:
Mouse   165 DSGPGR------------PLSCLMEEPAPYTDGTGAAAGGGNCRFVESPSQDQRLLVQRLRNPEV 217

  Fly  2035 GGIPEVEIDLSNTDWTIFRAVQELLQCSQLNKLDKFRKIWEPTYTIVYREVSPEAQESTCLESEE 2099
            .| |                    ||..| |:              .:...|||..|.....:..
Mouse   218 RG-P--------------------LQTPQ-NR--------------PHGHQSPELPEGYEQRTTV 246

  Fly  2100 FPQTPDVSSKSGASTL-SPNSPMHIGFNVADNNLCSVDD--VLELLTQ--------INGLNQSEI 2153
            ..|...:.:::|.||. .|..|..:|      .:...|:  :.|.|.|        :|.:|..|:
Mouse   247 QGQVYFLHTQTGVSTWHDPRIPSPLG------TIPGGDEAFLYEFLLQGHTSEPRDLNSVNCDEL 305

  Fly  2154 DS-----DVKEHGVSVLSEDLFISKKITNKLQQQIQDPLVLASNALPNWCENLNQSCPFLFPFET 2213
            ..     :|:.   :|.....|:..   |....|..||.:  .:.:.:.|:....|.|...|.|.
Mouse   306 GPLPPGWEVRS---TVSGRIYFVDH---NNRTTQFTDPRL--HHIMNHQCQLKEPSQPLQLPSEG 362

  Fly  2214 RQLYFNCTSFGASRSIVCLQSQRDVTVERQRIPIMSPRRD--------DHEFRIGRLK--HERVK 2268
                                     :||.:.:|.....||        .||..:.:.:  |.|::
Mouse   363 -------------------------SVEDEELPAQRYERDLVQKLKVLRHELSLQQPQAGHCRIE 402

  Fly  2269 VPRNEDLLMWAMQVMKTH-CNRKSVLEVEFLDEEGTGLGPTLEFYALVAAEIQRSDLCMW---LC 2329
            |.|.|.......|:||.. .:.|..|.|:|..|||..       |..||.|        |   ||
Mouse   403 VSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLD-------YGGVARE--------WLYLLC 452

  Fly  2330 DDDLGEDTENSTQSAEGNSKPVGYY--VNRREHGIFPAPLPQNSEICENVLKYFWFFGVFVAKVL 2392
            .:.|..                 ||  .......|:...:..:|.|..:.|.||.|.|       
Mouse   453 HEMLNP-----------------YYGLFQYSTDNIYTLQINPDSSINPDHLSYFHFVG------- 493

  Fly  2393 QDMRLVDIPLSTSFLQLLCHNKVLSRNLQKVISDRRNGDLSVVSEDSDIVETCTKLLRTDSNKSN 2457
               |::.:        .:.|...:            ||..:        |....:||        
Mouse   494 ---RIMGL--------AVFHGHYI------------NGGFT--------VPFYKQLL-------- 519

  Fly  2458 AFGGILSLENLKEIDPTRYQFLQEMQNLLLRKQSIEFDDTISAEKKHELINELKLQTQNGLEVSL 2522
              |..:.|.:|:.:||                               ||...|....:|.:...|
Mouse   520 --GKPIQLSDLESVDP-------------------------------ELHKSLVWILENDITPVL 551

  Fly  2523 EDLALTFTYLPSSSIYG-YTQAELLPNGSSVNVTIDNLEAYCELLMNFILQDGIAQQMKAFSDGF 2586
            :     .|:....:.:| ..|.||.|||.:|.||.:|.:.|..|.:|:....||..|..|...||
Mouse   552 D-----HTFCVEHNAFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGF 611

  Fly  2587 NEVFPLKKLAAFTPSEARMMICG---EQFPHWSREDIISYTEPKLGYNKDSPGFQRFVNVLLSMS 2648
            ||:.|...|..|...|..::|.|   .....|.....:.:..      .||...:.|...:.:..
Mouse   612 NELIPQHLLKPFDQKELELIIGGLDKIDLNDWKSNTRLKHCV------ADSNIVRWFWQAVETFD 670

  Fly  2649 GDERKAFLQFTTGCSSLPPGGLANLH-------PRLTVVRKVDAGVGSYPSVNTCVHYLKLPDYP 2706
            .:.|...|||.||.:.:|..|...|.       |||..:..:||...:.|..:||.:.:.:|.|.
Mouse   671 EERRARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYE 735

  Fly  2707 TEEIMKERLLTATKEK-GF 2724
            :.|.:.|:||||.:|. ||
Mouse   736 SYEKLYEKLLTAVEETCGF 754

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ufd4NP_609369.1 ANK repeat 393..420 CDD:293786
ANK 396..509 CDD:238125
ANK repeat 422..453 CDD:293786
ANK repeat 455..484 CDD:293786
F5_F8_type_C 1173..1298 CDD:329041
MIB_HERC2 1333..1389 CDD:310955
DamX 1576..>1725 CDD:330571
HECTc 2265..2725 CDD:238033 110/478 (23%)
Smurf1XP_006504947.1 C2_Smurf-like 14..138 CDD:176028
WW 236..267 CDD:197736 6/30 (20%)
WW 307..339 CDD:197736 7/37 (19%)
HECTc 399..754 CDD:238033 108/476 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.