DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ufd4 and Herc3

DIOPT Version :9

Sequence 1:NP_609369.1 Gene:Ufd4 / 34378 FlyBaseID:FBgn0032208 Length:2727 Species:Drosophila melanogaster
Sequence 2:NP_001348895.1 Gene:Herc3 / 73998 MGIID:1921248 Length:1050 Species:Mus musculus


Alignment Length:779 Identity:155/779 - (19%)
Similarity:241/779 - (30%) Gaps:329/779 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly  2130 NNLCSVDDVLELLTQINGLNQSEIDSDVKEH--------GVS-----VLSEDL------FISKKI 2175
            ||..:|:.|:::|:.....|.|.::..:.||        |:.     :|.|.|      .|.::|
Mouse   418 NNANTVNGVVQILSSAACWNGSFLEKKIDEHFKTSPKIPGIDLNSTRILFEKLMHSQHSMILEQI 482

  Fly  2176 TNKLQQ--------------------------QIQD---------PLVLA--------SNALPNW 2197
            .|..:.                          .:||         ||.:|        |..|.||
Mouse   483 LNSFESCLIPQLSSSPPDVEAMRIYLILPEFPLLQDSKYYITLTIPLAMAILRLETNPSKVLDNW 547

  Fly  2198 CENLNQSCPFLFPFETRQLYFNCTSFGASRSIVCLQSQRDVTVERQRIPIMSPRRDDH------- 2255
               .:|:||..|                 ..:|.|.....:.:.|.|...:.|...::       
Mouse   548 ---WSQACPKYF-----------------MKLVTLYKGAVLYLLRGRKTFLIPVLFNNYMTATLK 592

  Fly  2256 --------EFRIGRLKHERVKVPR-------NEDLLMW--------------------------- 2278
                    ..::..:::::..:|.       .||.|||                           
Mouse   593 LLEKLYKVNLKVKHVEYDKFYIPEISSLVDIQEDYLMWFLHQSGMKARPSIMQDAVTLCSYPFIF 657

  Fly  2279 ---------------AMQVMKTHCNRKSV------------------------------------ 2292
                           .|||.....|.::|                                    
Mouse   658 DAQAKTKMLQTDAELQMQVAVNGANLQNVFMLLTLEPLLARSPFLVLHVRRNHLVGDALRELSIH 722

  Fly  2293 --------LEVEFLDEEGTGL-GPTLEFYALVAAEIQRSDLCMWLCDDDLGEDTENSTQSAEGNS 2348
                    |:|.|..|||... |.|.||:.|:..|:                            .
Mouse   723 SDIDLKKPLKVIFDGEEGVDAGGVTKEFFLLLLKEL----------------------------L 759

  Fly  2349 KPVGYYVNRREHGIFPAPLPQN----SEICENVLKYFWF--FGVFVAKVLQDMRLVDI--PLSTS 2405
            .|:        :|:|......|    |:.|  .:::.||  .|:.....:.:..:||:  ||:  
Mouse   760 NPI--------YGMFTYYQDSNLLWFSDTC--FVEHNWFHLIGITCGLAIYNSTVVDLHFPLA-- 812

  Fly  2406 FLQLLCHNKVLSRNLQKVISDRRNGDLSVVSEDSDIVETCTKLLRTDSNKSNAFGGILSLENLKE 2470
                          |.|                        |||....          |||:|||
Mouse   813 --------------LYK------------------------KLLNVKP----------SLEDLKE 829

  Fly  2471 IDPTRYQFLQEMQNLLLRKQSIEFDDTISAEKKHELINELKLQTQNGLEVSLEDLALTFTYLPSS 2535
            :.||..:.|||:  |....:.||                             |...|.||....|
Mouse   830 LSPTEGRSLQEL--LDYPGEDIE-----------------------------ETFCLNFTVCRES 863

  Fly  2536 SIYG-YTQAELLPNGSSVNVTIDNLEAYCELLMNFILQDGIAQQMKAFSDGFNEVFPLKKLAAFT 2599
              || ..|.:|:|.|..|.|..||.:.:.:..:|:|.|..:.:...|||.||.:|...|.|..|.
Mouse   864 --YGVIEQKKLIPGGDRVAVCKDNRQEFVDAYVNYIFQISVHEWYTAFSSGFLKVCGGKVLELFQ 926

  Fly  2600 PSEARMMICGEQFPHWSR-EDIISYTEPKLGYNKDSPGFQRFVNVLLSMSGDERKAFLQFTTGCS 2663
            |:|.|.|:.|.....|.. |:...|   :..|:...|..:.|.........:::|.||.|.||..
Mouse   927 PAELRAMMVGNSNYDWEELEETAVY---RGDYSSTHPTVKLFWETFHEFPLEKKKKFLLFLTGSD 988

  Fly  2664 SLPPGGLANLHPRLTVVRKVDAGVGSYPSVNTCVHYLKLPDYPTEEIMKERLLTATKE-KGFHL 2726
            .:|..|:|:|.   .:::....|....|..:||.:.|.||.|.::||||.||..|... :||.|
Mouse   989 RIPIYGMASLQ---IIIQSTATGEEYLPVAHTCYNLLDLPKYSSKEIMKARLTQALDNYEGFSL 1049

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ufd4NP_609369.1 ANK repeat 393..420 CDD:293786
ANK 396..509 CDD:238125
ANK repeat 422..453 CDD:293786
ANK repeat 455..484 CDD:293786
F5_F8_type_C 1173..1298 CDD:329041
MIB_HERC2 1333..1389 CDD:310955
DamX 1576..>1725 CDD:330571
HECTc 2265..2725 CDD:238033 119/564 (21%)
Herc3NP_001348895.1 ATS1 2..331 CDD:227511
RCC1 313..377 CDD:366085
HECTc 702..1048 CDD:238033 108/472 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.