DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ufd4 and SMURF1

DIOPT Version :9

Sequence 1:NP_609369.1 Gene:Ufd4 / 34378 FlyBaseID:FBgn0032208 Length:2727 Species:Drosophila melanogaster
Sequence 2:NP_065162.1 Gene:SMURF1 / 57154 HGNCID:16807 Length:757 Species:Homo sapiens


Alignment Length:576 Identity:126/576 - (21%)
Similarity:192/576 - (33%) Gaps:177/576 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  2177 NKLQQQIQDPLVLASNALPNWCENLNQSCPFLFPFETRQLYFNCTSFGASRSIVCLQSQRDVTVE 2241
            |....|..||.:  .:.:.:.|:....|.|...|.|.                         ::|
Human   328 NNRTTQFTDPRL--HHIMNHQCQLKEPSQPLPLPSEG-------------------------SLE 365

  Fly  2242 RQRIPIMSPRRD--------DHEFRIGRLK--HERVKVPRNEDLLMWAMQVMKTH-CNRKSVLEV 2295
            .:.:|.....||        .||..:.:.:  |.|::|.|.|.......|:||.. .:.|..|.|
Human   366 DEELPAQRYERDLVQKLKVLRHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMV 430

  Fly  2296 EFLDEEGTGLGPTLEFYALVAAEIQRSDLCMW---LCDDDLGEDTENSTQSAEGNSKPVGYY--V 2355
            :|..|||..       |..||.|        |   ||.:.|..                 ||  .
Human   431 KFRGEEGLD-------YGGVARE--------WLYLLCHEMLNP-----------------YYGLF 463

  Fly  2356 NRREHGIFPAPLPQNSEICENVLKYFWFFGVFVAKVLQDMRLVDIPLSTSFLQLLCHNKVLSRNL 2420
            ......|:...:..:|.|..:.|.||.|.|          |::.:        .:.|...:    
Human   464 QYSTDNIYMLQINPDSSINPDHLSYFHFVG----------RIMGL--------AVFHGHYI---- 506

  Fly  2421 QKVISDRRNGDLSVVSEDSDIVETCTKLLRTDSNKSNAFGGILSLENLKEIDPTRYQFLQEMQNL 2485
                    ||..:        |....:||          |..:.|.:|:.:||            
Human   507 --------NGGFT--------VPFYKQLL----------GKPIQLSDLESVDP------------ 533

  Fly  2486 LLRKQSIEFDDTISAEKKHELINELKLQTQNGLEVSLEDLALTFTYLPSSSIYG-YTQAELLPNG 2549
                               ||...|....:|.:...|:     .|:....:.:| ..|.||.|||
Human   534 -------------------ELHKSLVWILENDITPVLD-----HTFCVEHNAFGRILQHELKPNG 574

  Fly  2550 SSVNVTIDNLEAYCELLMNFILQDGIAQQMKAFSDGFNEVFPLKKLAAFTPSEARMMICG---EQ 2611
            .:|.||.:|.:.|..|.:|:....||..|..|...||||:.|...|..|...|..::|.|   ..
Human   575 RNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLDKID 639

  Fly  2612 FPHWSREDIISYTEPKLGYNKDSPGFQRFVNVLLSMSGDERKAFLQFTTGCSSLPPGGLANLH-- 2674
            ...|.....:.:..      .||...:.|...:.:...:.|...|||.||.:.:|..|...|.  
Human   640 LNDWKSNTRLKHCV------ADSNIVRWFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGS 698

  Fly  2675 -----PRLTVVRKVDAGVGSYPSVNTCVHYLKLPDYPTEEIMKERLLTATKEK-GF 2724
                 |||..:..:||...:.|..:||.:.:.:|.|.:.|.:.|:||||.:|. ||
Human   699 TGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGF 754

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ufd4NP_609369.1 ANK repeat 393..420 CDD:293786
ANK 396..509 CDD:238125
ANK repeat 422..453 CDD:293786
ANK repeat 455..484 CDD:293786
F5_F8_type_C 1173..1298 CDD:329041
MIB_HERC2 1333..1389 CDD:310955
DamX 1576..>1725 CDD:330571
HECTc 2265..2725 CDD:238033 110/478 (23%)
SMURF1NP_065162.1 C2_Smurf-like 14..138 CDD:176028
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..237
WW 236..267 CDD:197736
WW 307..339 CDD:197736 4/10 (40%)
HECTc 399..754 CDD:238033 108/476 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.