DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ufd4 and ASCC1

DIOPT Version :9

Sequence 1:NP_609369.1 Gene:Ufd4 / 34378 FlyBaseID:FBgn0032208 Length:2727 Species:Drosophila melanogaster
Sequence 2:NP_001185728.1 Gene:ASCC1 / 51008 HGNCID:24268 Length:400 Species:Homo sapiens


Alignment Length:251 Identity:52/251 - (20%)
Similarity:96/251 - (38%) Gaps:62/251 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 NVLEVTARAITYYLDVSAECTRRIVSIDGAI----KAICNHLVVADLSSRTSRDLAEQCIKVLEL 129
            |.:||....:.:..:|.|:|:.. ..:|.:|    |.:  ||.:..|...:..::.:.| ::|: 
Human   170 NEVEVQEGFLRFQEEVLAKCSMD-HGVDSSIFQNPKKL--HLTIGMLVLLSEEEIQQTC-EMLQ- 229

  Fly   130 ICTREAGAVFEGGGLNCVLSFIRDCGS----QVHK---DTLHSAMSVVSRLCTKV--EPNTPCIQ 185
                           .|...||.|...    :|..   :.::....:|..|..||  :..:..:|
Human   230 ---------------QCKEEFINDISGGKPLEVEMAGIEYMNDDPGMVDVLYAKVHMKDGSNRLQ 279

  Fly   186 NCVESLSTLLQHEDPMVSD-GALKCFASVADRFTRKWVDPAPLAEYGLTT--------------- 234
            ..|:.:....|....:|.: .::|..|:|.:...||  ||.....|.|.|               
Human   280 ELVDRVLERFQASGLIVKEWNSVKLHATVMNTLFRK--DPNAEGRYNLYTAEGKYIFKERESFDG 342

  Fly   235 -------ELLKRLQ---SVGGNTHSSLTAAGTQPTSSSQPAATTN-SDAINENVAG 279
                   .||.||:   ::..:.:..|..:...|.|:||.|..|. |||.::::.|
Human   343 RNILKSFALLPRLEYNDAISAHCNLCLPGSSDSPASASQVAGITGVSDAYSQSLPG 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ufd4NP_609369.1 ANK repeat 393..420 CDD:293786
ANK 396..509 CDD:238125
ANK repeat 422..453 CDD:293786
ANK repeat 455..484 CDD:293786
F5_F8_type_C 1173..1298 CDD:329041
MIB_HERC2 1333..1389 CDD:310955
DamX 1576..>1725 CDD:330571
HECTc 2265..2725 CDD:238033
ASCC1NP_001185728.1 Required for interaction with ASCC3. /evidence=ECO:0000269|PubMed:29997253 1..53
vigilin_like_KH 99..148 CDD:239087
PLN00108 157..370 CDD:177724 41/221 (19%)
AKAP7_NLS 161..349 CDD:287446 37/200 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.