DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ufd4 and bag3

DIOPT Version :9

Sequence 1:NP_609369.1 Gene:Ufd4 / 34378 FlyBaseID:FBgn0032208 Length:2727 Species:Drosophila melanogaster
Sequence 2:NP_001003533.1 Gene:bag3 / 445139 ZFINID:ZDB-GENE-040801-40 Length:459 Species:Danio rerio


Alignment Length:368 Identity:68/368 - (18%)
Similarity:128/368 - (34%) Gaps:102/368 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1474 QIISNQLAMNTSSSREARAKHKESGTNQMHKDNISG---PSPLSRE-----LEHISDLSAINNSM 1530
            :|.||..:|:..:.::   .|| :..|:|.:..:..   |.|:..|     |:.....|.|:   
Zfish    43 KIFSNGPSMSPETPQD---MHK-TFINEMRQPMLRQGYIPIPVCHENPEPRLQQYPSFSYIH--- 100

  Fly  1531 PAINSSNVSDLATISENLSLTELSKENICRVLTPSYKPAESVTASQSSSH-PDVQSSSPRENDIK 1594
            ||:.    .:|.|.....|.|..:.   ||..:|...|:|:.::...:|| |:..........|.
Zfish   101 PAVQ----QNLRTDGRTPSPTPAAH---CRPRSPVQTPSEACSSCSPTSHGPEGYQPQGTHQQIS 158

  Fly  1595 NI------SN--------------------IEENNKMNANNSVNKISKDLLANLRTSNIAGCPPV 1633
            .:      ||                    :......:::.:..||.::.:......|.|..|..
Zfish   159 GLHQQPRSSNTGLRAGYIPIPVIHEGAGGVLPSQLSQSSHPTREKIYREQVPIQIQQNRAASPIQ 223

  Fly  1634 TQLSTEALEMIDKMRDGVDMIRNMSNSILST-------DTFPVPCTNVPVGGKKTPKAQALINPD 1691
            ..|..::..|...|.:...|.:::.::.:.:       :...||...||:  ::..:....|:..
Zfish   224 VPLRAQSPVMAQIMGERPQMQQHIGHTAIPSKIEHPVEEIIRVPTFEVPI--QRVSEVPQQIHHQ 286

  Fly  1692 NANQKQIIVTSEEFPTKSSKKPSVTLKPAQQPNAVLSIVDIKEQPISNENVSVPSQMSISVP--- 1753
            ...|:|                    :|.|||..       |.||  :..||..|.::|.||   
Zfish   287 PVQQQQ--------------------QPTQQPQP-------KAQP--SPQVSETSNITIQVPPAP 322

  Fly  1754 ----NLTTTSASEVPST--------SEVATHTGLLETFAAIAR 1784
                .....:..||||:        .:..:|.||::....:.|
Zfish   323 EPQETAAPQTPQEVPSSQLQPEETLEQDLSHPGLVKVQQIVER 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ufd4NP_609369.1 ANK repeat 393..420 CDD:293786
ANK 396..509 CDD:238125
ANK repeat 422..453 CDD:293786
ANK repeat 455..484 CDD:293786
F5_F8_type_C 1173..1298 CDD:329041
MIB_HERC2 1333..1389 CDD:310955
DamX 1576..>1725 CDD:330571 26/182 (14%)
HECTc 2265..2725 CDD:238033
bag3NP_001003533.1 WW 6..38 CDD:197736
BAG 358..432 CDD:214591 1/8 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.