DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ufd4 and Herc4

DIOPT Version :9

Sequence 1:NP_609369.1 Gene:Ufd4 / 34378 FlyBaseID:FBgn0032208 Length:2727 Species:Drosophila melanogaster
Sequence 2:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster


Alignment Length:653 Identity:129/653 - (19%)
Similarity:221/653 - (33%) Gaps:208/653 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  2106 VSSKSGASTLSPNSPMHIGFNVADNNLCSVDDVLELLTQINGLNQSEID------------SDVK 2158
            :|.|.|.:..||::.........:..|..:..:::.|.|||......::            :||:
  Fly   585 ISFKMGLAAASPSAERRQQLLPYNTELEIILKLMKTLCQINNERHDRLNYQIFYWPDLSDYADVQ 649

  Fly  2159 EHGVSVLSEDLFISKKITNK---LQQQIQDPLVLASNALPNWCENLNQSCPFLFPFETRQLYFNC 2220
            :..|..:..|......|.|.   ..|..:..|:.|..||.......|.:          .:.|:.
  Fly   650 QEYVKWIMADTARDFNICNYSFIFDQSAKTALLQADQALQMHSAMANAA----------TMAFSF 704

  Fly  2221 TSFG--ASRSIVCLQSQRDVTVERQRIPIMSPRRDDHEFRIGRLKHERVKVPRNEDLLMWAMQVM 2283
            .::|  .|:.||       :.|.|:.:...|.|...|.              ...||        
  Fly   705 FNYGMPISQFIV-------LNVTRENLVQDSLRELQHY--------------SQSDL-------- 740

  Fly  2284 KTHCNRKSVLEVEFLDEEGTGLGPT-LEFYALVA-----------AEIQRSDLCMWLCDDDLGED 2336
                  |..|:::|..||....|.. .||:.|:.           .|.::|.| :|..  ||..:
  Fly   741 ------KKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFKEYEQSRL-LWFA--DLTFE 796

  Fly  2337 TENSTQSAEGNSKPVGYYVNRREHGIFPAPLPQNSEICENVLKYFWFFGVFVAKVLQDMRLVDIP 2401
            |||                                        .::..||.....:.:..::::|
  Fly   797 TEN----------------------------------------MYFLIGVLCGLAIYNFTIINLP 821

  Fly  2402 LSTSFLQLLCHNKVLSRNLQKVISDRRNGDLSVVSEDSDIVETCTKLLRTDSNKSNAFGGILSLE 2466
            ...:..:                                      |||          |..:.|.
  Fly   822 FPLALFK--------------------------------------KLL----------GKPVDLS 838

  Fly  2467 NLKEIDPTRYQFLQEMQNLLLRKQSIEFDDTISAEKKHELINELKLQTQNGLEVSLEDLALTFTY 2531
            :|:::.|.....:|.    ||..|..:|.:...                           |||..
  Fly   839 DLRQLSPPEANSMQS----LLDYQGDDFKEVFD---------------------------LTFEI 872

  Fly  2532 LPSSSIYGYTQAELL-PNGSSVNVTIDNLEAYCELLMNFILQDGIAQQMKAFSDGFNEVFPLKKL 2595
              |..::|..:.:.| |||:.:.||::|.:.:.:|.::|:....:.....||..||.:|...:.:
  Fly   873 --SRDVFGEAETKCLKPNGNEIAVTLENRQEFVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVI 935

  Fly  2596 AAFTPSEARMMICGEQFPHW-SREDIISYTEPKLGYNKDSPGFQRFVNVLLSMSGDERKAFLQFT 2659
            ..|.|.|...::.|.:...| :.:|...|.|   ||.......:.|..|:..||..|:|:||.|.
  Fly   936 HIFQPEELMAVVVGNEDYDWQALQDNCEYRE---GYTSVDDTIKWFWEVIHDMSEAEKKSFLLFL 997

  Fly  2660 TGCSSLPPGGLANLHPRLTVVRKVDAGVGSYPSVNTCVHYLKLPDYPTEEIMKERLLTATKE-KG 2723
            ||...:|..|:..|  :||:....|...  .|..:||.:.|.||.|.|:|.:|.:||.|.:: :|
  Fly   998 TGSDRIPIQGMKAL--KLTIQPTPDERF--LPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQG 1058

  Fly  2724 FHL 2726
            |.|
  Fly  1059 FSL 1061

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ufd4NP_609369.1 ANK repeat 393..420 CDD:293786
ANK 396..509 CDD:238125
ANK repeat 422..453 CDD:293786
ANK repeat 455..484 CDD:293786
F5_F8_type_C 1173..1298 CDD:329041
MIB_HERC2 1333..1389 CDD:310955
DamX 1576..>1725 CDD:330571
HECTc 2265..2725 CDD:238033 95/474 (20%)
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 102/510 (20%)
HECTc 739..1059 CDD:214523 94/464 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446940
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.