DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ufd4 and yki

DIOPT Version :9

Sequence 1:NP_609369.1 Gene:Ufd4 / 34378 FlyBaseID:FBgn0032208 Length:2727 Species:Drosophila melanogaster
Sequence 2:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster


Alignment Length:557 Identity:94/557 - (16%)
Similarity:168/557 - (30%) Gaps:207/557 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  1614 ISKDLLANLRTSNIAGCPPVTQL--STEALEMIDKMRDGVDMIRNMSNSILSTDTFPVPCTN--V 1674
            |:|.:|.:.|...|:....:|.:  |:....:|:|..|..||:.            |:...|  |
  Fly     6 IAKIILCSFRLYTISAFYMLTTMSASSNTNSLIEKEIDDEDMLS------------PIKSNNLVV 58

  Fly  1675 PVGGKKTPKAQAL----INPDNANQKQIIVTSEEFPTKSSKKPSVTLKPAQQPNAVLSIVDIKEQ 1735
            .|........|||    :||.:|.:..      :.|.:..|.|:....|....::..:..|....
  Fly    59 RVNQDTDDNLQALFDSVLNPGDAKRPL------QLPLRMRKLPNSFFTPPAPSHSRANSADSTYD 117

  Fly  1736 PISNENVSVPSQMSI-----------SVPNLTTTSASEVPSTSEVATHTGLLETFAAIARRRTSQ 1789
            ..|..::::.::.||           ::|.|....:   |..|.:|.|..          |..|.
  Fly   118 AGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPS---PQHSRLAIHHS----------RARSS 169

  Fly  1790 GTNIQDNQIMNAEANVNEHGDQNASGSFLGHSVTSLVKLALSSNFHSGLLSTAQSYPSLSSNNSE 1854
            ..::|.|..:.|.::.....:.||:.|                         :|..|:       
  Fly   170 PASLQQNYNVRARSDAAAANNPNANPS-------------------------SQQQPA------- 202

  Fly  1855 NIAPSNPSNTSAGQQSASTINHTLTMSLTSTSSDSEQVSLEDFLESCRAPALLGDLDDEDDMDED 1919
              .|:.|.|                             |.::|.....|.:.: |||        
  Fly   203 --GPTFPEN-----------------------------SAQEFPSGAPASSAI-DLD-------- 227

  Fly  1920 NDEEENEDEYEEVGNTLLQVMVSRNLLTFMDDEAMENRLVGVTKRKSWD--DEFVLKRQFSALIP 1982
                        ..||.:...:..::.|..            .|::|:|  ....|.||..||.|
  Fly   228 ------------AMNTCMSQDIPMSMQTVH------------KKQRSYDVISPIQLNRQLGALPP 268

  Fly  1983 AFDPRPGRTNVNQTSDLEISPLGAELPKPQQSGGPETIEQPLLGLKLRGPGIGGIPEVEIDLSNT 2047
            .::..       :|:|.:|..|.......|...                      |.::      
  Fly   269 GWEQA-------KTNDGQIYYLNHTTKSTQWED----------------------PRIQ------ 298

  Fly  2048 DWTIFRAVQELLQCSQLNKLDKFRKIWEPTYTIVYREVS--PEAQESTCLESEEFPQTPDVSSKS 2110
                :|..|::|...::.:.|..:...:.|.:.:...:.  |:..|....||.:......:.   
  Fly   299 ----YRQQQQILMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHID--- 356

  Fly  2111 GASTLSPNSP-MHIGFNVAD------------NNLCS 2134
              .|.|.|.| |..|.:|.|            :||||
  Fly   357 --RTTSWNDPRMQSGLSVLDCPDNLVSSLQIEDNLCS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ufd4NP_609369.1 ANK repeat 393..420 CDD:293786
ANK 396..509 CDD:238125
ANK repeat 422..453 CDD:293786
ANK repeat 455..484 CDD:293786
F5_F8_type_C 1173..1298 CDD:329041
MIB_HERC2 1333..1389 CDD:310955
DamX 1576..>1725 CDD:330571 26/118 (22%)
HECTc 2265..2725 CDD:238033
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 32/175 (18%)
WW 266..295 CDD:395320 7/57 (12%)
WW 335..364 CDD:395320 7/33 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.