DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ufd4 and Arel1

DIOPT Version :9

Sequence 1:NP_609369.1 Gene:Ufd4 / 34378 FlyBaseID:FBgn0032208 Length:2727 Species:Drosophila melanogaster
Sequence 2:NP_001100214.1 Gene:Arel1 / 299197 RGDID:1307597 Length:823 Species:Rattus norvegicus


Alignment Length:996 Identity:185/996 - (18%)
Similarity:303/996 - (30%) Gaps:404/996 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly  1924 ENEDEYEEVGNTLLQVMVSRNLLTFMDDEAMENRLVGVTKRKSWD--DEFVLKRQFSALIPAF-- 1984
            :|||. |..|:..:...|..|   ::|..:.         :.|||  |.:.:....:..:..|  
  Rat    34 QNEDR-ERRGDRTIYDYVRGN---YLDPRSC---------KVSWDWKDPYEVGHSMAFRVHLFYK 85

  Fly  1985 --DPRPGRTNVNQTSDLEISPLGAELPKPQQSGGPETIEQP-----LLGLKLRGPG-------IG 2035
              .|.|....|.....:....|..|:|..|     |.:::|     .:...:|..|       :|
  Rat    86 NGQPFPAHRPVGLRVHISHVELAVEIPVTQ-----EVLQEPNSNVVKVAFTVRKAGRYEITVKLG 145

  Fly  2036 GIPEVEIDLSNTDWTIFRAVQE------------------LLQCSQLNKL-----DKF------- 2070
            |:        |..::.:..:.:                  :|.|.|.:.|     |::       
  Rat   146 GL--------NVAYSPYYKIFQPGMVVPSKTKIVCHFSTLVLTCGQPHTLQIVPRDEYDNPTNNS 202

  Fly  2071 ---RKIWEPTYTIVYREVSPEAQEST-------------------------------CLESEEFP 2101
               |:  |..|::...|:.|:.:|::                               |:..:..|
  Rat   203 MSLRE--EHNYSLSIHELGPQEEENSEVSFEKSVTSNRQTCQVFLRLTLHSRGCFHACISYQNQP 265

  Fly  2102 -----------------------QTPDVSSKSGASTLSPNS---------PMHIGFNVADNNLCS 2134
                                   .|..||....|...:.||         |||:..:....:   
  Rat   266 INNGEFDIIVLSENEKNIVERNVSTSGVSIYFEAYLYNANSYSSAPWHLPPMHMSSSQRRPS--- 327

  Fly  2135 VDDVLELLTQINGLNQSEIDS-------------------------DVKEHGVSVLSEDLF---- 2170
                       ..|.:.|.||                         .|||..:.::...|:    
  Rat   328 -----------TALEEEEEDSPSECHTPEKVKKPKKVYCYVSPKQFSVKEFYLKIIPWRLYTFRV 381

  Fly  2171 -------------ISKKITNKLQQQIQDPL--------VLASNALPNWCENLNQSCPF-----LF 2209
                         :.|.:|..:...||.|:        :||:..:.:..:|:..|..|     .|
  Rat   382 CPGTKFSYLGPDPVHKLLTLVVDDGIQPPVELSCKERNILAATFIRSLHKNIGGSETFQDKVNFF 446

  Fly  2210 PFETRQLYFNCTSFGASRSIVCLQSQRDVTVERQRIPIMSPRRDDHEFRIGRLKHERVKVPRNED 2274
            ..|.||::..     ...|.|.|:..|...:|                       ..:|..||..
  Rat   447 QRELRQVHMK-----RPHSKVTLKVSRHALLE-----------------------SSLKATRNFS 483

  Fly  2275 LLMWAMQVMKTHCNRKSVLEVEFLDEEGTGL-GPTLEFYALVAAEIQRSDLCMWLCDDDLGEDTE 2338
            :..|:..           .||.|.|||.... ||..|::.|:         |..|.|    ..::
  Rat   484 ISDWSKN-----------FEVVFQDEEALDWGGPRREWFELI---------CKALFD----TTSQ 524

  Fly  2339 NSTQSAEGNSKPVGYYVNRREHGIFPAPLPQNSEICENVLKYFWFFGVFVAKVLQD-------MR 2396
            ..|:.::.|...|....||      ||.|.         ||.:.|.|..|.|.|.:       .:
  Rat   525 LFTRFSDNNQALVHPNPNR------PAHLR---------LKMYEFAGRLVGKCLYESSLGGAYKQ 574

  Fly  2397 LVDIPLSTSFLQLLCHNKVLSRNLQKVISDRRNGDLSVVSEDSDIVETCTKLLRTDSNKSNAFGG 2461
            ||....:.||             |.::|..|.:                .|...||         
  Rat   575 LVRARFTRSF-------------LAQIIGLRMH----------------YKYFETD--------- 601

  Fly  2462 ILSLENLKEIDPTRYQFLQEMQNLLLRKQSIEFDDTISAEKKHELINEL-KLQTQNGLEVSLEDL 2525
                      ||   :|.:.....:|.....|. :.:.||:|:....:| |:             
  Rat   602 ----------DP---EFYKSKVCFILNNDMSEM-ELVFAEEKYNKSGQLDKI------------- 639

  Fly  2526 ALTFTYLPSSSIYGYTQAELLPNGSSVNVTIDNLEAYCELLMNFILQDGIAQQMKAFSDGFNEVF 2590
                             .||:..|:...||..|...|..||..:.|...:.::::.|..|.||:.
  Rat   640 -----------------VELMTGGAQTPVTNANKTFYLNLLAQYRLASQVKEEVEHFLKGLNELV 687

  Fly  2591 PLKKLAAFTPSEARMMICG------EQFP--------HWS-REDIISYTEPKLGYNKDSPGFQRF 2640
            |...||.|..:|..:::||      ..|.        .|. ||.::.:                |
  Rat   688 PENLLAIFDENELELLMCGTGDISVSDFKAHAVVVGGSWHFREKVMRW----------------F 736

  Fly  2641 VNVLLSMSGDERKAFLQFTTGCSSLPPGGLANLHPRLTVVRKVDAGVGSYPSVNTCVHYLKLPDY 2705
            ..|:.|::.:|....||||||.|.|||||.|.|.|...::.....  .:.|:.:||.:.|.||.|
  Rat   737 WTVVSSLTQEELARLLQFTTGSSQLPPGGFAALCPSFQIIAAPTH--STLPTAHTCFNQLCLPTY 799

  Fly  2706 PTEEIMKERLLTATKE--KGF 2724
            .:.|.:...|..|..|  :||
  Rat   800 DSYEEVHRMLQLAISEGCEGF 820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ufd4NP_609369.1 ANK repeat 393..420 CDD:293786
ANK 396..509 CDD:238125
ANK repeat 422..453 CDD:293786
ANK repeat 455..484 CDD:293786
F5_F8_type_C 1173..1298 CDD:329041
MIB_HERC2 1333..1389 CDD:310955
DamX 1576..>1725 CDD:330571
HECTc 2265..2725 CDD:238033 109/486 (22%)
Arel1NP_001100214.1 Filamin 56..154 CDD:395505 20/119 (17%)
HECTc 486..820 CDD:214523 104/472 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.