Sequence 1: | NP_609369.1 | Gene: | Ufd4 / 34378 | FlyBaseID: | FBgn0032208 | Length: | 2727 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001020040.1 | Gene: | Wwtr1 / 295062 | RGDID: | 1559609 | Length: | 395 | Species: | Rattus norvegicus |
Alignment Length: | 269 | Identity: | 56/269 - (20%) |
---|---|---|---|
Similarity: | 91/269 - (33%) | Gaps: | 93/269 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 1721 QQPNAVLSIVDIKEQPISNENV-------SVPSQ-MSISVPNL-----------TTTSASEVPST 1766
Fly 1767 SEVATHTGLLETFAAIARRRTSQ-------------GTNIQDNQIMNAEA--------------- 1803
Fly 1804 ------NVNEHGDQNASGS-FLG----HSVTSLVKLALSSNFHSGLLSTAQSYPSLSSNNSENIA 1857
Fly 1858 PSNPSNTSAGQQSASTINHTLTMSLTSTSSDSEQVSLEDFLESCRAPAL-LGDLDDEDDMDEDND 1921
Fly 1922 EEE--NEDE 1928 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ufd4 | NP_609369.1 | ANK repeat | 393..420 | CDD:293786 | |
ANK | 396..509 | CDD:238125 | |||
ANK repeat | 422..453 | CDD:293786 | |||
ANK repeat | 455..484 | CDD:293786 | |||
F5_F8_type_C | 1173..1298 | CDD:329041 | |||
MIB_HERC2 | 1333..1389 | CDD:310955 | |||
DamX | 1576..>1725 | CDD:330571 | 2/3 (67%) | ||
HECTc | 2265..2725 | CDD:238033 | |||
Wwtr1 | NP_001020040.1 | WW | 125..156 | CDD:197736 | 1/2 (50%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5021 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |