DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ufd4 and Wwtr1

DIOPT Version :9

Sequence 1:NP_609369.1 Gene:Ufd4 / 34378 FlyBaseID:FBgn0032208 Length:2727 Species:Drosophila melanogaster
Sequence 2:NP_001020040.1 Gene:Wwtr1 / 295062 RGDID:1559609 Length:395 Species:Rattus norvegicus


Alignment Length:269 Identity:56/269 - (20%)
Similarity:91/269 - (33%) Gaps:93/269 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1721 QQPNAVLSIVDIKEQPISNENV-------SVPSQ-MSISVPNL-----------TTTSASEVPST 1766
            |.|..|::      ||:::.|:       |||.: |::|.|||           |:.|....|:.
  Rat   153 QDPRKVMN------QPLNHVNLHPTITSTSVPQRSMAVSQPNLAMNHQHQQVVATSLSPQNHPAQ 211

  Fly  1767 SEVATHTGLLETFAAIARRRTSQ-------------GTNIQDNQIMNAEA--------------- 1803
            :   ..|||:....|:..::..|             ...::..::|..||               
  Rat   212 N---PPTGLMSVPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMETETMAP 273

  Fly  1804 ------NVNEHGDQNASGS-FLG----HSVTSLVKLALSSNFHSGLLSTAQSYPSLSSNNSENIA 1857
                  |.:.....|:|.. ||.    ||        ...:..|||.....|.|:...:...|:.
  Rat   274 VNTPAMNTDMRSVTNSSSDPFLNGGPYHS--------REQSTDSGLGLGCYSVPTTPEDFLSNMD 330

  Fly  1858 PSNPSNTSAGQQSASTINHTLTMSLTSTSSDSEQVSLEDFLESCRAPAL-LGDLDDEDDMDEDND 1921
            ..:....|.  |:..|:|             .:|....|||:......: ||.|:.||.:...||
  Rat   331 EMDTGENSG--QTPMTVN-------------PQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFND 380

  Fly  1922 EEE--NEDE 1928
            .|.  |:.|
  Rat   381 VESALNKSE 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ufd4NP_609369.1 ANK repeat 393..420 CDD:293786
ANK 396..509 CDD:238125
ANK repeat 422..453 CDD:293786
ANK repeat 455..484 CDD:293786
F5_F8_type_C 1173..1298 CDD:329041
MIB_HERC2 1333..1389 CDD:310955
DamX 1576..>1725 CDD:330571 2/3 (67%)
HECTc 2265..2725 CDD:238033
Wwtr1NP_001020040.1 WW 125..156 CDD:197736 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.