DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ufd4 and Bag3

DIOPT Version :9

Sequence 1:NP_609369.1 Gene:Ufd4 / 34378 FlyBaseID:FBgn0032208 Length:2727 Species:Drosophila melanogaster
Sequence 2:NP_001011936.1 Gene:Bag3 / 293524 RGDID:1307794 Length:574 Species:Rattus norvegicus


Alignment Length:657 Identity:120/657 - (18%)
Similarity:205/657 - (31%) Gaps:223/657 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1362 GW---IDVK--W----DHGVR----NSYRMGAEGKYDLKLADCEYLSAFDGNQSMGSASTAAKPS 1413
            ||   ||.:  |    ||..|    |..|:..||..:                   :||:|..||
  Rat    27 GWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPPEGPKE-------------------TASSANGPS 72

  Fly  1414 EKGGNTLTSRKSSSTPSLP-------------EATEKNQ-------NPEGASNQTVSADNLAWKQ 1458
            ..|...|.:|:..  |..|             |.:|..|       :..|.......|...|.::
  Rat    73 RDGSRLLPAREGH--PIYPQLRPGYIPIPVHHEGSENRQPHLFHAYSQPGVQRFRTEAAAAAPQR 135

  Fly  1459 TVETIAENVFASAKTQIISNQL-AMNTSSSREARAKHKESGTNQMHKDNISGPSPLSRELEHISD 1522
            :...:...|..:.:|.....|: |..|:....|....:..             ||.:      ||
  Rat   136 SQSPLRGGVTETTQTDKQCGQVPAAATAQPPTAHGPERSQ-------------SPAA------SD 181

  Fly  1523 LSAINN--SMPAINSSNVSDLATISENLSLTELSKENICR-VLTPSYKPAESV--TASQSSSHPD 1582
            .|:.::  |:|:...|::.........:.:..:.::||.| ...||:..|:..  .|.|....|.
  Rat   182 CSSSSSSASLPSSGRSSLGSHQLPRGYIPIPVIHEQNITRPAAQPSFHQAQKTHYPAQQGEYQPQ 246

  Fly  1583 ----------------VQSSSPRENDIKNISNIEENNKMNANNSVNKISKDLLANLRTSNIAG-- 1629
                            ::::||..:.::..|: .|.:...:...|:..|.     :|...:..  
  Rat   247 QPVYHKIQGDDWEPRPLRATSPFRSPVRGASS-REGSPARSGTPVHCPSP-----IRVHTVVDRP 305

  Fly  1630 -------CPPVTQLSTEALEMIDKMRDG------------VDMIRNMSNSILSTDTFPVPCTNVP 1675
                   .|||||...:     .:.:.|            :.:||..::|             .|
  Rat   306 QPMTHREPPPVTQPENK-----PESKPGLAGPDLPPGHIPIQVIRREADS-------------KP 352

  Fly  1676 VGGKKTPKAQALINPDNANQKQIIVTSEEFPTKSSKKPSVTLKPAQQPNAVLSIVDIKEQPISNE 1740
            |..|..|.|:.:         ::.|:|...|..|         |...|:||         |.|.:
  Rat   353 VSQKPPPPAEKV---------EVKVSSAPIPCPS---------PGPAPSAV---------PSSPK 390

  Fly  1741 NVSVPSQMSISVPNLTTTSASEVPSTSEVA--THTGLLETFAAIARRRTSQGTNIQDNQIMNAEA 1803
            ||:...:   :.|:.....|:.:.|....|  .|.|:|:..|.:.:        :|         
  Rat   391 NVAAEPK---AAPSPAPAEAASLKSGDAEAPHKHPGVLKVEAILEK--------VQ--------- 435

  Fly  1804 NVNEHGDQNASGSFLGHSVTSLVKLALSSNFHSGLLSTAQSYPSLSSNNSENIAPSNPSNTSAGQ 1868
                 |.:.|..:|.|.. |....|.:.......||       :|.|.:.|..|....:... |.
  Rat   436 -----GLEQAVDNFEGKK-TDKKYLMIEEYLTKELL-------ALDSVDPEGRADVRQARRD-GV 486

  Fly  1869 QSASTINHTLTMSLTSTSSDSEQVSLEDFLESCRAPALLGDLDDEDDMDE-------DNDEE--E 1924
            :...||...|...........:...|:.           .:|:.|..:.|       |.|::  |
  Rat   487 RKVQTILEKLEQKAIDVPGQVQVYELQP-----------SNLEPEQPLQEIMGAVAADKDKKGPE 540

  Fly  1925 NEDEYEE 1931
            |||...|
  Rat   541 NEDPQTE 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ufd4NP_609369.1 ANK repeat 393..420 CDD:293786
ANK 396..509 CDD:238125
ANK repeat 422..453 CDD:293786
ANK repeat 455..484 CDD:293786
F5_F8_type_C 1173..1298 CDD:329041
MIB_HERC2 1333..1389 CDD:310955 12/39 (31%)
DamX 1576..>1725 CDD:330571 29/185 (16%)
HECTc 2265..2725 CDD:238033
Bag3NP_001011936.1 WW 23..55 CDD:197736 9/27 (33%)
BAG 423..500 CDD:214591 20/107 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.