DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Utx and LONRF3

DIOPT Version :9

Sequence 1:NP_609368.3 Gene:Utx / 34377 FlyBaseID:FBgn0260749 Length:1136 Species:Drosophila melanogaster
Sequence 2:XP_005262533.1 Gene:LONRF3 / 79836 HGNCID:21152 Length:811 Species:Homo sapiens


Alignment Length:486 Identity:100/486 - (20%)
Similarity:156/486 - (32%) Gaps:152/486 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 LLGRCYAGINKVHDAFLAYRNSVEKSEGNADTWCSIGVLYQQQNQPTDALQAYICAVQLDKDHKA 375
            |||:.:.|         ..|.|..:.|||.        ||::: |...||..|..||:|..:...
Human   232 LLGKLFPG---------PARASQLRHEGNR--------LYRER-QVEAALLKYNEAVKLAPNDHL 278

  Fly   376 AWTNLGILYESC----GQLRDA-YACYLNATKQISFQKSSLIRKKQAIRMKKDTIGLSKGLSQRI 435
            .::|...:|.:.    ..|.|| .||.|   :.:.|:  :..||.||:.    |:|         
Human   279 LYSNRSQIYFTLESHENALHDAEIACKL---RPMGFK--AHFRKAQALA----TLG--------- 325

  Fly   436 TFLEGQLSQAPLPSITSKRRQLCSIEEA---WNLPISLE-MNSRQQQTAQMLPRQVTKQSPVQGP 496
                                   .:|||   :...:||: .|.|.:..||.|......       
Human   326 -----------------------KVEEALREFLYCVSLDGKNKRARCEAQRLLLSFFS------- 360

  Fly   497 PPPYPHSQLSQSP------IPSKRIKEDGTSQ-QEVTQNNSQTSAQNLINISESLNQRNFNAMPE 554
             |..|......||      .|..|:||:..|. .|||.:|.....|:.:.:....:|....|   
Human   361 -PSVPGDSQEHSPDILKLLAPHPRLKENVESMTTEVTSHNLPRLLQDNLELPHCSSQEEAAA--- 421

  Fly   555 SNKSSEQSVLDTF----DDISNDIYKQNESIKLERLSQDALSNNEDSRHDFIGGDNADISTTFKI 615
              :....|::|..    |...:.:..|.|    |....||.|            ..|..|.|.|.
Human   422 --RGDGSSLMDPAKVKGDGQQHHMKDQEE----EEEKWDATS------------PKAASSKTGKC 468

  Fly   616 QMDSKQLMVAVKLLPIDEPPVHCTI-LQVNAPPP---SPPDCPPQKLTRDQLLPPTPSVHLENKK 676
            |...::               ||.| .|.....|   |..|.|..:..:..|..|..|....:.:
Human   469 QEKKRK---------------HCQIESQEETGMPNKASKQDPPTDQGDKPALSLPLASFDASDLE 518

  Fly   677 -----------------HAFSPQLQEFCLKH----PIAVVRGLAGVL---KLDLGLFSTKTLVEA 717
                             |.|..:..|.||.|    |:. ..||:..|   |....:...:.:.:.
Human   519 CALCMRLFYEPVTTPCGHTFCLKCLERCLDHNAKCPLC-KDGLSQCLASRKYSKNVIMEELIAKF 582

  Fly   718 NPDHSVEVRTQVHQSPDENWDTSQGKRVWAC 748
            .|:...|.|....:..:|..:.::...::.|
Human   583 LPEELKERRKLYEEEMEELSNLNKNVPIFVC 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UtxNP_609368.3 TPR repeat 147..181 CDD:276809
TPR_11 156..216 CDD:290150
TPR repeat 186..216 CDD:276809
TPR repeat 228..255 CDD:276809
TPR_11 264..337 CDD:290150 6/25 (24%)
TPR repeat 265..300 CDD:276809
TPR repeat 307..334 CDD:276809 6/22 (27%)
TPR_11 339..402 CDD:290150 18/67 (27%)
TPR repeat 339..369 CDD:276809 9/29 (31%)
TPR_1 340..373 CDD:278916 9/32 (28%)
TPR repeat 374..402 CDD:276809 8/32 (25%)
JmjC 870..978 CDD:202224
LONRF3XP_005262533.1 RING 158..195 CDD:302633
TPR_11 242..308 CDD:290150 22/77 (29%)
TPR repeat 243..271 CDD:276809 11/36 (31%)
TPR repeat 276..306 CDD:276809 7/29 (24%)
TPR repeat 311..334 CDD:276809 10/60 (17%)
RING 518..557 CDD:238093 7/39 (18%)
LON_substr_bdg 607..808 CDD:280370 1/7 (14%)
LON 618..796 CDD:271862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.