Sequence 1: | NP_609368.3 | Gene: | Utx / 34377 | FlyBaseID: | FBgn0260749 | Length: | 1136 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001070789.1 | Gene: | spag1b / 768178 | ZFINID: | ZDB-GENE-061013-512 | Length: | 591 | Species: | Danio rerio |
Alignment Length: | 256 | Identity: | 45/256 - (17%) |
---|---|---|---|
Similarity: | 85/256 - (33%) | Gaps: | 66/256 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 LIRELDSRYYGFLDLSNSKNAELRNLVQQTITNLQNYIANGQVHESKNSSDNKNAIQKFEPSTQA 75
Fly 76 GEHMENTSS------------RNNDDTKPFE---QDAKEKVSIIEEKHQDE-------------- 111
Fly 112 ---HYVNALCKLGHLHLLLGEYSEALSAYQKYLRFRENN--YWTNHAFIYGIGVAYFKLRCFKWA 171
Fly 172 IKSFQELLYLSPN------------------FTCANEVH--LRLGLMLKHCGEFHIALKHL 212 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Utx | NP_609368.3 | TPR repeat | 147..181 | CDD:276809 | 9/35 (26%) |
TPR_11 | 156..216 | CDD:290150 | 14/77 (18%) | ||
TPR repeat | 186..216 | CDD:276809 | 7/29 (24%) | ||
TPR repeat | 228..255 | CDD:276809 | |||
TPR_11 | 264..337 | CDD:290150 | |||
TPR repeat | 265..300 | CDD:276809 | |||
TPR repeat | 307..334 | CDD:276809 | |||
TPR_11 | 339..402 | CDD:290150 | |||
TPR repeat | 339..369 | CDD:276809 | |||
TPR_1 | 340..373 | CDD:278916 | |||
TPR repeat | 374..402 | CDD:276809 | |||
JmjC | 870..978 | CDD:202224 | |||
spag1b | NP_001070789.1 | TPR_11 | 194..258 | CDD:290150 | |
TPR repeat | 198..222 | CDD:276809 | |||
TPR repeat | 226..256 | CDD:276809 | |||
TPR_16 | 233..294 | CDD:290168 | |||
TPR repeat | 261..289 | CDD:276809 | |||
TPR repeat | 483..513 | CDD:276809 | 9/35 (26%) | ||
TPR_11 | 486..548 | CDD:290150 | 13/67 (19%) | ||
TPR_1 | 486..517 | CDD:278916 | 10/36 (28%) | ||
TPR repeat | 518..546 | CDD:276809 | 1/27 (4%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |