DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Utx and Ttc32

DIOPT Version :9

Sequence 1:NP_609368.3 Gene:Utx / 34377 FlyBaseID:FBgn0260749 Length:1136 Species:Drosophila melanogaster
Sequence 2:XP_003750178.1 Gene:Ttc32 / 684830 RGDID:1585566 Length:148 Species:Rattus norvegicus


Alignment Length:147 Identity:27/147 - (18%)
Similarity:57/147 - (38%) Gaps:19/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 GEKKEREANALNFLQ-KSIEADPKSGQSLY--LLGRCYAGINKV--HDAFLAYRNSVEKSEGNAD 341
            |.::.....||...| :....|....:.||  .:|:|.:..:|.  .|...||.|..:....:.|
  Rat     6 GRERGESPAALAMAQARFARGDFTEARELYSAFIGQCASHRSKCSPEDLATAYNNRGQTKYFSVD 70

  Fly   342 TWCSIGVLYQQQNQPTDALQAYICAVQLDKDHKAAWTNLGILYESCGQLRDAYACYLNATKQISF 406
            .:              :|:..|..|:::..:.:..:.|.|::....|...:|...:..|..:...
  Rat    71 FY--------------EAMDDYTSAIEILPNFEVPYYNRGLIRYRLGYFDEAVEDFKKALDRNPA 121

  Fly   407 QKSSLIRKKQAIRMKKD 423
            .:.:::..||.|..|::
  Rat   122 FQDAVLSLKQTILDKEE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UtxNP_609368.3 TPR repeat 147..181 CDD:276809
TPR_11 156..216 CDD:290150
TPR repeat 186..216 CDD:276809
TPR repeat 228..255 CDD:276809
TPR_11 264..337 CDD:290150 14/59 (24%)
TPR repeat 265..300 CDD:276809 4/18 (22%)
TPR repeat 307..334 CDD:276809 9/30 (30%)
TPR_11 339..402 CDD:290150 9/62 (15%)
TPR repeat 339..369 CDD:276809 4/29 (14%)
TPR_1 340..373 CDD:278916 4/32 (13%)
TPR repeat 374..402 CDD:276809 5/27 (19%)
JmjC 870..978 CDD:202224
Ttc32XP_003750178.1 TPR_11 14..86 CDD:290150 17/85 (20%)
TPR repeat 14..48 CDD:276809 8/33 (24%)
TPR repeat 53..84 CDD:276809 8/44 (18%)
TPR_11 55..120 CDD:290150 12/78 (15%)
TPR_1 55..88 CDD:278916 7/46 (15%)
TPR repeat 89..117 CDD:276809 5/27 (19%)
TPR_1 92..120 CDD:278916 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.