DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Utx and Dnaaf4

DIOPT Version :9

Sequence 1:NP_609368.3 Gene:Utx / 34377 FlyBaseID:FBgn0260749 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_080590.3 Gene:Dnaaf4 / 67685 MGIID:1914935 Length:420 Species:Mus musculus


Alignment Length:434 Identity:81/434 - (18%)
Similarity:144/434 - (33%) Gaps:136/434 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 NADTWCSIGVLYQQQNQPTDALQAYICAVQLDKDHKAAWTNLGILYESCGQLRDAYACYLNATKQ 403
            :||.:|  |..|.:.|.|....:.::.|...|...||...|..||:                   
Mouse    30 DADVFC--GESYLKVNFPPFLFELFLYAPIDDGKSKAKIGNDTILF------------------- 73

  Fly   404 ISFQKSSLIRKKQAIRMKKDTIGLSKGLSQRI---TFLEGQ--LSQAPLPSITSKRR-------Q 456
                  :|.:|:..:.......|:.|.:.|||   :.|:.|  ..:|......:||.       :
Mouse    74 ------TLYKKEPVLWDSLSVPGVDKEMMQRIREKSILQAQEKAKEATEAKAVAKREDQRYALGE 132

  Fly   457 LCSIEEAWNLPI-SLEMNSRQQQTAQM------------LPRQVTKQSPVQG------------- 495
            :..|||.....| .::.|.|::.|:::            ..|...|:.|::|             
Mouse   133 MMKIEEEERKKIEDMKENERKKATSELEAWKECQKKADGQKRVQRKEKPLEGKQAEETKALKPRG 197

  Fly   496 -----PPPPYPHSQLSQSPIPSKRIKEDGTSQQEVTQNNSQTSAQNLINISESLNQRNF-NAMPE 554
                 ||...|....:...|..:::|||     .|....|..|      |..|...|.| .|:.|
Mouse   198 LPRKAPPTRLPTRGRNWENIFPEKLKED-----RVPAPRSAGS------IQISFTPRVFPTALRE 251

  Fly   555 SNKSSEQSVLDTFDDISNDIYKQNES-------------IKLERLSQDALSNNEDSRHDFIGGDN 606
            |..:.|:..|          :||.|:             :|.|..:.|.|.:.         |:.
Mouse   252 SQVAEEEEWL----------HKQAEARRAMSTDLPEFFDLKEEERNPDWLKDK---------GNK 297

  Fly   607 ADISTTFKIQMDSKQLMV----AVKLLPIDEPPVHCTILQVNAPPPSPPDCPPQKLTRD-----Q 662
            ...:..:...:|:..|.:    .:.||.::....|..:..::            |...|     :
Mouse   298 LFATENYLAAVDAYNLAIRLNCKIPLLYLNRAACHLKLKNLH------------KAIEDSSKALE 350

  Fly   663 LLPPTPSVHLENKKHAFSPQLQEFC-LKHPIAVVRGLAGVLKLD 705
            ||.|..:.:...:..|...:...|| |:..:..::.....||:|
Mouse   351 LLTPPVADNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKID 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UtxNP_609368.3 TPR repeat 147..181 CDD:276809
TPR_11 156..216 CDD:290150
TPR repeat 186..216 CDD:276809
TPR repeat 228..255 CDD:276809
TPR_11 264..337 CDD:290150
TPR repeat 265..300 CDD:276809
TPR repeat 307..334 CDD:276809
TPR_11 339..402 CDD:290150 14/62 (23%)
TPR repeat 339..369 CDD:276809 8/29 (28%)
TPR_1 340..373 CDD:278916 9/32 (28%)
TPR repeat 374..402 CDD:276809 5/27 (19%)
JmjC 870..978 CDD:202224
Dnaaf4NP_080590.3 Mediates interaction with ESR1 and STUB1. /evidence=ECO:0000250 7..103 21/99 (21%)
p23_DYX1C1_like 10..87 CDD:107226 16/83 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..212 7/47 (15%)
TPR_11 287..351 CDD:290150 10/84 (12%)
TPR 1 288..321 5/41 (12%)
TPR repeat 288..316 CDD:276809 5/36 (14%)
TPR repeat 321..351 CDD:276809 5/41 (12%)
TPR 2 322..355 7/44 (16%)
TPR_1 322..351 CDD:278916 5/40 (13%)
TPR_12 324..396 CDD:290160 14/83 (17%)
TPR repeat 362..392 CDD:276809 4/29 (14%)
TPR 3 364..397 7/31 (23%)
TPR_1 365..397 CDD:278916 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.