DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Utx and Tomm34

DIOPT Version :9

Sequence 1:NP_609368.3 Gene:Utx / 34377 FlyBaseID:FBgn0260749 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_001278084.1 Gene:Tomm34 / 67145 MGIID:1914395 Length:309 Species:Mus musculus


Alignment Length:389 Identity:73/389 - (18%)
Similarity:126/389 - (32%) Gaps:120/389 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 GEKKEREANALNFLQKSIEADPKSGQSLYL-LGRCYAGINKVHDAFLAYRNSVEKSEGNADTWCS 345
            ||.......||..||....|||:....||. ...||.                  .:||.     
Mouse    26 GEASALYERALRLLQARGSADPEEESVLYSNRAACYL------------------KDGNC----- 67

  Fly   346 IGVLYQQQNQPTDALQAYICAVQLDKDHKAAWTNLGILYESCGQLRDAYACYLNATKQISFQKSS 410
                       ||.::....|:.|..............||:..:...||..|....:..:...|:
Mouse    68 -----------TDCIKDCTSALALVPFSIKPLLRRASAYEALEKYALAYVDYKTVLQIDNSVASA 121

  Fly   411 LIRKKQAIRMKKDTIGLSKGLSQRITFLEGQLSQAPLPSITSKRRQLCSIEEAWN-LPISLEMNS 474
            |....:..|...|::|           .|.:|...|:|.:.      .|.::.|| ||     :.
Mouse   122 LEGINRITRALMDSLG-----------PEWRLKLPPIPVVP------VSAQKRWNSLP-----SD 164

  Fly   475 RQQQTAQMLPRQVTKQSPVQGPPPPYPHSQLSQSPIPS-------KRIKEDGTSQQEVTQNNSQT 532
            ..::||:...::.|                .::|.:||       |.:||:|...  |.:.|.:.
Mouse   165 NHKETAKTKSKEAT----------------ATKSRVPSAGDVERAKALKEEGNDL--VKKGNHKK 211

  Fly   533 SAQNLINISESLNQRNFNAMPESNKSSEQSVLDTFDDISNDIYKQNESIKLERLSQDALSNNEDS 597
            :.:   ..||||...:..:...||::....||..:.:...|.   .|::||:..:..|....   
Mouse   212 AIE---KYSESLLCSSLESATYSNRALCHLVLKQYKEAVKDC---TEALKLDGKNVKAFYRR--- 267

  Fly   598 RHDFIGGDNADISTTFKIQMDSKQLMVAVKLLPIDEPPVHCTILQVNAPPPSPPDCPPQKLTRD 661
                        :..:|...|.|..:..:.           ::||:     .|.:.|.|||.::
Mouse   268 ------------AQAYKALKDYKSSLSDIS-----------SLLQI-----EPRNGPAQKLRQE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UtxNP_609368.3 TPR repeat 147..181 CDD:276809
TPR_11 156..216 CDD:290150
TPR repeat 186..216 CDD:276809
TPR repeat 228..255 CDD:276809
TPR_11 264..337 CDD:290150 13/55 (24%)
TPR repeat 265..300 CDD:276809 6/17 (35%)
TPR repeat 307..334 CDD:276809 4/27 (15%)
TPR_11 339..402 CDD:290150 10/62 (16%)
TPR repeat 339..369 CDD:276809 4/29 (14%)
TPR_1 340..373 CDD:278916 4/32 (13%)
TPR repeat 374..402 CDD:276809 5/27 (19%)
JmjC 870..978 CDD:202224
Tomm34NP_001278084.1 TPR 3 85..118 5/32 (16%)
TPR repeat 85..113 CDD:276809 5/27 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..189 10/51 (20%)
TPR_11 192..257 CDD:290150 17/72 (24%)
TPR 4 193..226 10/37 (27%)
TPR repeat 193..221 CDD:276809 9/32 (28%)
TPR repeat 226..256 CDD:276809 6/32 (19%)
TPR 5 227..260 8/35 (23%)
TPR_1 229..260 CDD:278916 8/33 (24%)
TPR 6 261..294 7/63 (11%)
TPR 1 9..42 6/15 (40%)
TPR repeat 9..37 CDD:276809 3/10 (30%)
TPR_11 10..82 CDD:290150 19/89 (21%)
TPR_11 50..115 CDD:290150 15/98 (15%)
TPR repeat 50..80 CDD:276809 9/63 (14%)
TPR 2 51..84 10/66 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.