| Sequence 1: | NP_609368.3 | Gene: | Utx / 34377 | FlyBaseID: | FBgn0260749 | Length: | 1136 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001082875.2 | Gene: | spag1a / 564953 | ZFINID: | ZDB-GENE-030131-9443 | Length: | 386 | Species: | Danio rerio |
| Alignment Length: | 215 | Identity: | 36/215 - (16%) |
|---|---|---|---|
| Similarity: | 70/215 - (32%) | Gaps: | 78/215 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 317 AGINKVHDAFLAYRNSVE--KSEGNADTWCSIGVLYQQQNQPTDALQAYICAVQLDKDHKAAWTN 379
Fly 380 LGILYESCGQLRDAYACYLNATKQISFQKSSLIRKKQAIRMKKDTIGLSKGLSQRITFL----EG 440
Fly 441 QLSQAPLPSITSKRRQLCSIEEAWNLPISLEMNSRQQQTAQMLP--------------------- 484
Fly 485 ----RQVTKQSPVQGPPPPY 500 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Utx | NP_609368.3 | TPR repeat | 147..181 | CDD:276809 | |
| TPR_11 | 156..216 | CDD:290150 | |||
| TPR repeat | 186..216 | CDD:276809 | |||
| TPR repeat | 228..255 | CDD:276809 | |||
| TPR_11 | 264..337 | CDD:290150 | 6/21 (29%) | ||
| TPR repeat | 265..300 | CDD:276809 | |||
| TPR repeat | 307..334 | CDD:276809 | 6/16 (38%) | ||
| TPR_11 | 339..402 | CDD:290150 | 12/62 (19%) | ||
| TPR repeat | 339..369 | CDD:276809 | 4/29 (14%) | ||
| TPR_1 | 340..373 | CDD:278916 | 4/32 (13%) | ||
| TPR repeat | 374..402 | CDD:276809 | 7/27 (26%) | ||
| JmjC | 870..978 | CDD:202224 | |||
| spag1a | NP_001082875.2 | TPR_11 | 87..157 | CDD:290150 | 12/55 (22%) |
| TPR repeat | 87..112 | CDD:276809 | |||
| TPR repeat | 125..155 | CDD:276809 | 7/45 (16%) | ||
| TPR_11 | 128..190 | CDD:290150 | 15/88 (17%) | ||
| TPR repeat | 160..188 | CDD:276809 | 7/38 (18%) | ||
| TPR_11 | 263..326 | CDD:290150 | 5/22 (23%) | ||
| TPR repeat | 263..289 | CDD:276809 | 5/22 (23%) | ||
| TPR repeat | 294..324 | CDD:276809 | |||
| TPR_11 | 297..360 | CDD:290150 | |||
| TPR_1 | 297..328 | CDD:278916 | |||
| TPR repeat | 329..357 | CDD:276809 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||