DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Utx and BBS4

DIOPT Version :9

Sequence 1:NP_609368.3 Gene:Utx / 34377 FlyBaseID:FBgn0260749 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster


Alignment Length:492 Identity:94/492 - (19%)
Similarity:168/492 - (34%) Gaps:128/492 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIRELDSRY----YGFLDLSNSKNAE-LRNLVQQTITNLQNYIANGQVHESKNSSDNKNAIQKFE 70
            |.|.|:..|    .|.:|.....:.| ||:|.:....|.:|      :...|........:.:|.
  Fly    60 LNRHLNPEYLYFVQGLIDREEGNHIEALRHLQKSAELNPRN------IETYKEIGRTLYIMGRFS 118

  Fly    71 PSTQAGEHMENTSSRNNDDTKPFEQDAKEKVSIIEEKHQDEHYVNALCKLGHLHLLLGE--YSEA 133
            .:.......|..|||         ||           |:..||             |||  |..|
  Fly   119 QALGVFREAEQRSSR---------QD-----------HEIYHY-------------LGELLYRAA 150

  Fly   134 LSAYQKYLRFRENNYWTNHAFIYGIGVAYFKLRCFKWAIKSFQELLYLSPNFTCANEVHLRLGLM 198
            .:..||.:..::.:.          ...||:|     |::|.::|           |.::||..:
  Fly   151 TTQSQKDVASQQQDE----------ARTYFEL-----AVQSGRKL-----------ESYVRLAEL 189

  Fly   199 LKHCGEFHIALKHLQLALLYTYPSTFSELQVKFQIAHLYEVQNKHKAAKDGYEFLLNEKNISLEL 263
            .:...::..|::.|:..|..|..::    :|..:|:.||...|:.:.|.|..     .:.:|:|.
  Fly   190 YRKDKQYQKAIEILENCLHLTPENS----EVLIEISVLYLKINETQKAHDRL-----AEVVSIER 245

  Fly   264 KADVYRQLGWMYHCVECLGEKKEREANALNFLQKSIEADPKSGQSLYLLGRCYAGINKVHDAFLA 328
            |......|.:     ..:.:.:.....||:...:...|:|:..:....:|.|:....|...|..:
  Fly   246 KCSPKGLLAF-----GAILQSRNDIDGALSKYSQIANAEPEIAELWNNIGLCFFKKQKFIVAISS 305

  Fly   329 YRNSVEKSEGNADTWCSIGVLYQQQNQPTDALQAYICAVQLDKDHKAAWTNLGILYESCGQLRDA 393
            .|.||..|..|.:...::.::|....|...|......|:.|.||:...:..||:.......:.:|
  Fly   306 LRKSVWLSPLNYNALYNLSLIYIASEQYASAFHTLAAAINLRKDNAECYMLLGLCLRKLDDMENA 370

  Fly   394 YACYLNATKQISFQKSSLIRKKQAIRMKKDTIGLSKGLSQRITFLEGQLSQAPLPSITSKRRQLC 458
            :         ::.:::|                         :...||......|.:.......|
  Fly   371 F---------VALERAS-------------------------SMATGQQGAGRNPLVVLNFALFC 401

  Fly   459 SIEEAWNLPISLEMNSRQQQTAQ--MLPR----QVTK 489
              .|...|.:|.|..:|....||  :||.    |.||
  Fly   402 --YETGRLALSTEQYNRFMSQAQDLLLPTEYKFQATK 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UtxNP_609368.3 TPR repeat 147..181 CDD:276809 6/33 (18%)
TPR_11 156..216 CDD:290150 11/59 (19%)
TPR repeat 186..216 CDD:276809 5/29 (17%)
TPR repeat 228..255 CDD:276809 7/26 (27%)
TPR_11 264..337 CDD:290150 13/72 (18%)
TPR repeat 265..300 CDD:276809 3/34 (9%)
TPR repeat 307..334 CDD:276809 6/26 (23%)
TPR_11 339..402 CDD:290150 11/62 (18%)
TPR repeat 339..369 CDD:276809 5/29 (17%)
TPR_1 340..373 CDD:278916 6/32 (19%)
TPR repeat 374..402 CDD:276809 3/27 (11%)
JmjC 870..978 CDD:202224
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 12/69 (17%)
TPR repeat 68..95 CDD:276809 7/26 (27%)
TPR_12 97..175 CDD:290160 24/131 (18%)
TPR repeat 100..130 CDD:276809 4/35 (11%)
TPR repeat 136..175 CDD:276809 14/66 (21%)
TPR repeat 179..209 CDD:276809 7/40 (18%)
TPR_19 190..254 CDD:291240 14/72 (19%)
TPR repeat 214..242 CDD:276809 7/36 (19%)
TPR repeat 249..277 CDD:276809 3/32 (9%)
TPR_11 283..348 CDD:290150 14/64 (22%)
TPR repeat 283..311 CDD:276809 6/27 (22%)
TPR repeat 316..346 CDD:276809 5/29 (17%)
TPR repeat 351..377 CDD:276809 3/34 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.