DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Utx and tomm34

DIOPT Version :9

Sequence 1:NP_609368.3 Gene:Utx / 34377 FlyBaseID:FBgn0260749 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_955932.2 Gene:tomm34 / 323361 ZFINID:ZDB-GENE-030131-2081 Length:305 Species:Danio rerio


Alignment Length:147 Identity:38/147 - (25%)
Similarity:59/147 - (40%) Gaps:15/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GQVHESKNSSDNKNAI--QKFEPSTQAGEHMENTSSRNNDDTKPFE-QDAKEKV--SIIEEKHQD 110
            ||.....:||...|.|  :|..|...|.:.........|...|..| :.|.||.  |:.::..:.
Zfish   160 GQAASPASSSQQNNVIDDKKKAPGPDAVKKGRTLKEEGNALVKKGEHKKAMEKYTQSLAQDPTEV 224

  Fly   111 EHYVN-ALCKLGHLHLLLGEYSEALSAYQKYLRFRENNYWTNHAFIYGIGVAYFKLRCFKWAIKS 174
            ..|.| |||     :|.|..|.:|:...::.||...    .|...:|....||.:|:..|..|:.
Zfish   225 TTYTNRALC-----YLALKMYKDAIRDCEEALRLDS----ANIKALYRRAQAYKELKNKKSCIED 280

  Fly   175 FQELLYLSPNFTCANEV 191
            ...:|.:.||.|...::
Zfish   281 LNSVLKIDPNNTAVQKL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UtxNP_609368.3 TPR repeat 147..181 CDD:276809 8/33 (24%)
TPR_11 156..216 CDD:290150 10/36 (28%)
TPR repeat 186..216 CDD:276809 1/6 (17%)
TPR repeat 228..255 CDD:276809
TPR_11 264..337 CDD:290150
TPR repeat 265..300 CDD:276809
TPR repeat 307..334 CDD:276809
TPR_11 339..402 CDD:290150
TPR repeat 339..369 CDD:276809
TPR_1 340..373 CDD:278916
TPR repeat 374..402 CDD:276809
JmjC 870..978 CDD:202224
tomm34NP_955932.2 TPR_11 13..83 CDD:290150
TPR repeat 13..38 CDD:276809
TPR repeat 43..81 CDD:276809
TPR_11 54..116 CDD:290150
TPR repeat 86..114 CDD:276809
TPR_11 191..254 CDD:290150 18/67 (27%)
TPR repeat 191..218 CDD:276809 7/26 (27%)
TPR repeat 223..253 CDD:276809 10/34 (29%)
TPR_11 226..289 CDD:290150 19/71 (27%)
TPR 226..257 CDD:197478 11/39 (28%)
TPR_1 258..291 CDD:278916 8/32 (25%)
TPR repeat 258..286 CDD:276809 6/27 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.