DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Utx and DNAAF4

DIOPT Version :9

Sequence 1:NP_609368.3 Gene:Utx / 34377 FlyBaseID:FBgn0260749 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_570722.2 Gene:DNAAF4 / 161582 HGNCID:21493 Length:420 Species:Homo sapiens


Alignment Length:442 Identity:88/442 - (19%)
Similarity:153/442 - (34%) Gaps:150/442 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 NADTWCSIGVLYQQQNQPTDALQAYICAVQLDKDHKAAWTNLGILYESCGQLRDAYACYLNATKQ 403
            :.|.:|:..  |.:.|.|....:|::.|...|:..||...|..|::                   
Human    30 DTDVFCTEN--YLKVNFPPFLFEAFLYAPIDDESSKAKIGNDTIVF------------------- 73

  Fly   404 ISFQKSSLIRKKQAIRMKKDTIGLSKGLSQRI---TFLEGQ--LSQAPLPSITSKRRQ------- 456
                  :|.:|:.|:.......|:.|.:.|||   :.|:.|  ..:|......:||..       
Human    74 ------TLYKKEAAMWETLSVTGVDKEMMQRIREKSILQAQERAKEATEAKAAAKREDQKYALSV 132

  Fly   457 LCSIEEAWNLPI-SLEMNSRQQQTAQM-----LPRQVTKQSPVQGPPPPYPHSQLSQSPIPSKRI 515
            :..|||.....| .::.|.|.:.|..:     ..|:..:|..:|      ...:|.|.   .|:|
Human   133 MMKIEEEERKKIEDMKENERIKATKALEAWKEYQRKAEEQKKIQ------REEKLCQK---EKQI 188

  Fly   516 KED--GTSQQEVTQN----NSQTSAQNLINI-SESLNQR-------------NF------NAMPE 554
            ||:  ....:.:|:|    |.....:|..|| :|.|.:.             ||      .|:.|
Human   189 KEERKKIKYKSLTRNLASRNLAPKGRNSENIFTEKLKEDSIPAPRSVGSIKINFTPRVFPTALRE 253

  Fly   555 SNKSSEQSVLDTFDDISNDIYKQNES-------------IKLERLSQDAL---SNNEDSRHDFIG 603
            |..:.|:..|          :||.|:             :|.|..:.:.|   .|...:..:::.
Human   254 SQVAEEEEWL----------HKQAEARRAMNTDIAELCDLKEEEKNPEWLKDKGNKLFATENYLA 308

  Fly   604 GDNADISTTFKIQMDSKQLMVAVKLLPIDEPPVHCTILQVNAPPPSPPDCPPQKLTRDQ------ 662
            ..||   ....|::::|     :.||.::....|..:..::            |...|.      
Human   309 AINA---YNLAIRLNNK-----MPLLYLNRAACHLKLKNLH------------KAIEDSSKALEL 353

  Fly   663 LLPP-TPSVHLENKKH-----AFSPQLQEFCLKHPIAVVRGL---AGVLKLD 705
            |:|| |.:.:...|.|     ||. ||:.:        |.||   ...||:|
Human   354 LMPPVTDNANARMKAHVRRGTAFC-QLELY--------VEGLQDYEAALKID 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UtxNP_609368.3 TPR repeat 147..181 CDD:276809
TPR_11 156..216 CDD:290150
TPR repeat 186..216 CDD:276809
TPR repeat 228..255 CDD:276809
TPR_11 264..337 CDD:290150
TPR repeat 265..300 CDD:276809
TPR repeat 307..334 CDD:276809
TPR_11 339..402 CDD:290150 12/62 (19%)
TPR repeat 339..369 CDD:276809 7/29 (24%)
TPR_1 340..373 CDD:278916 8/32 (25%)
TPR repeat 374..402 CDD:276809 4/27 (15%)
JmjC 870..978 CDD:202224
DNAAF4NP_570722.2 Mediates interaction with ESR1 and STUB1. /evidence=ECO:0000269|PubMed:19423554 7..103 20/99 (20%)
p23_DYX1C1_like 10..87 CDD:107226 15/83 (18%)
TPR_11 289..353 CDD:290150 11/83 (13%)
TPR 1 290..323 6/40 (15%)
TPR repeat 290..318 CDD:276809 4/30 (13%)
TPR repeat 323..353 CDD:276809 5/41 (12%)
TPR 2 324..357 6/44 (14%)
TPR repeat 364..394 CDD:276809 9/38 (24%)
TPR 3 366..399 12/40 (30%)
TPR_1 367..399 CDD:278916 12/39 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.