DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Utx and TTC32

DIOPT Version :10

Sequence 1:NP_609368.3 Gene:Utx / 34377 FlyBaseID:FBgn0260749 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_001008238.1 Gene:TTC32 / 130502 HGNCID:32954 Length:151 Species:Homo sapiens


Alignment Length:176 Identity:40/176 - (22%)
Similarity:63/176 - (35%) Gaps:57/176 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 IEEKHQDEHYVNALCKLGHLHLLLGEYSEALSAYQKYLR----------------------FREN 146
            :|.:.|:.|   |...|...|...|||:||.:.|..|:|                      ...|
Human     1 MEGQRQESH---ATLTLAQAHFNNGEYAEAEALYSAYIRRCACAASSDESPGSKCSPEDLATAYN 62

  Fly   147 NYWTNHAFIYGIGVAYFKLRCFKWAIKSFQELLYLSPNFTCANEV-HLRLGLMLKHCGEFHIALK 210
            |...         :.||::..:: |:..:...:.:.|||    || :...||:|...|.|..||:
Human    63 NRGQ---------IKYFRVDFYE-AMDDYTSAIEVQPNF----EVPYYNRGLILYRLGYFDDALE 113

  Fly   211 HLQLALLYTYPSTFSELQVKFQIAHL--------YEVQNKHKAAKD 248
            ..:..|         :|...||.|.|        .|.:.:...||:
Human   114 DFKKVL---------DLNPGFQDATLSLKQTILDKEEKQRRNVAKN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UtxNP_609368.3 TPR repeat 147..181 CDD:276809 4/33 (12%)
LapB 171..444 CDD:442196 22/87 (25%)
TPR repeat 186..216 CDD:276809 9/30 (30%)
TPR repeat 228..255 CDD:276809 7/29 (24%)
TPR repeat 265..300 CDD:276809
TPR repeat 307..334 CDD:276809
TPR repeat 339..369 CDD:276809
TPR repeat 374..402 CDD:276809
JmjC 870..978 CDD:396791
TTC32NP_001008238.1 TPR 1 8..41 12/35 (34%)
NlpI <14..132 CDD:443815 33/140 (24%)
TPR repeat 57..87 CDD:276809 5/39 (13%)
TPR 2 58..91 6/42 (14%)
TPR 3 92..125 11/41 (27%)
TPR repeat 92..120 CDD:276809 10/36 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.