Sequence 1: | NP_609368.3 | Gene: | Utx / 34377 | FlyBaseID: | FBgn0260749 | Length: | 1136 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006800.2 | Gene: | TOMM34 / 10953 | HGNCID: | 15746 | Length: | 309 | Species: | Homo sapiens |
Alignment Length: | 295 | Identity: | 60/295 - (20%) |
---|---|---|---|
Similarity: | 106/295 - (35%) | Gaps: | 92/295 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 388 GQLRDAYACYLNATKQISFQKSS-------LIRKKQAIRMK--------KD-TIGLS------KG 430
Fly 431 LSQRITFLEGQLSQAPLPSITSK--------------------RRQLCSIEEAWNL--------P 467
Fly 468 ISLE--MNSRQQQTAQMLPRQVTKQSPVQGPPPPYPHSQLSQSPIPS-------KRIKEDGTSQQ 523
Fly 524 EVTQNNSQTSAQNLINISESLNQRNFNAMPESNKSSEQSVLDTFDDISNDIYKQNESIKLERLSQ 588
Fly 589 DALSNN-------EDSRHDFIGGDNADISTTFKIQ 616 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Utx | NP_609368.3 | TPR repeat | 147..181 | CDD:276809 | |
TPR_11 | 156..216 | CDD:290150 | |||
TPR repeat | 186..216 | CDD:276809 | |||
TPR repeat | 228..255 | CDD:276809 | |||
TPR_11 | 264..337 | CDD:290150 | |||
TPR repeat | 265..300 | CDD:276809 | |||
TPR repeat | 307..334 | CDD:276809 | |||
TPR_11 | 339..402 | CDD:290150 | 6/13 (46%) | ||
TPR repeat | 339..369 | CDD:276809 | |||
TPR_1 | 340..373 | CDD:278916 | |||
TPR repeat | 374..402 | CDD:276809 | 6/13 (46%) | ||
JmjC | 870..978 | CDD:202224 | |||
TOMM34 | NP_006800.2 | TPR 1 | 9..42 | 6/18 (33%) | |
TPR repeat | 9..37 | CDD:276809 | 6/13 (46%) | ||
PLN03088 | <12..>294 | CDD:330826 | 60/295 (20%) | ||
TPR repeat | 50..80 | CDD:276809 | 7/29 (24%) | ||
TPR 2 | 51..84 | 7/32 (22%) | |||
TPR repeat | 85..113 | CDD:276809 | 7/28 (25%) | ||
TPR 3 | 86..118 | 7/32 (22%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 161..189 | 3/39 (8%) | |||
TPR 4 | 193..226 | 10/37 (27%) | |||
TPR repeat | 193..221 | CDD:276809 | 8/32 (25%) | ||
TPR repeat | 226..256 | CDD:276809 | 6/32 (19%) | ||
TPR 5 | 227..260 | 8/35 (23%) | |||
TPR repeat | 261..289 | CDD:276809 | 7/32 (22%) | ||
TPR 6 | 262..294 | 8/35 (23%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |