DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Utx and TOMM34

DIOPT Version :9

Sequence 1:NP_609368.3 Gene:Utx / 34377 FlyBaseID:FBgn0260749 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_006800.2 Gene:TOMM34 / 10953 HGNCID:15746 Length:309 Species:Homo sapiens


Alignment Length:295 Identity:60/295 - (20%)
Similarity:106/295 - (35%) Gaps:92/295 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 GQLRDAYACYLNATKQISFQKSS-------LIRKKQAIRMK--------KD-TIGLS------KG 430
            ||..:|.|.|..|.:.:..|.||       |...:.|..:|        || |..|:      |.
Human    23 GQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKP 87

  Fly   431 LSQRITFLEGQLSQAPLPSITSK--------------------RRQLCSIEEAWNL--------P 467
            |.:|.:..|. |.:.|:..:..|                    |..:.|:...|.|        |
Human    88 LLRRASAYEA-LEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVP 151

  Fly   468 ISLE--MNSRQQQTAQMLPRQVTKQSPVQGPPPPYPHSQLSQSPIPS-------KRIKEDGTSQQ 523
            :|.:  .||...:..:.:.:..:|::..            :::.:||       :.:||:|   .
Human   152 VSAQKRWNSLPSENHKEMAKSKSKETTA------------TKNRVPSAGDVEKARVLKEEG---N 201

  Fly   524 EVTQNNSQTSAQNLINISESLNQRNFNAMPESNKSSEQSVLDTFDDISNDIYKQNESIKLERLSQ 588
            |:.:..:...|  :...||||...|..:...||::....||..:.:...|.   .|::||:..:.
Human   202 ELVKKGNHKKA--IEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDC---TEALKLDGKNV 261

  Fly   589 DALSNN-------EDSRHDFIGGDNADISTTFKIQ 616
            .|....       :|.:..|     ||||...:|:
Human   262 KAFYRRAQAHKALKDYKSSF-----ADISNLLQIE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UtxNP_609368.3 TPR repeat 147..181 CDD:276809
TPR_11 156..216 CDD:290150
TPR repeat 186..216 CDD:276809
TPR repeat 228..255 CDD:276809
TPR_11 264..337 CDD:290150
TPR repeat 265..300 CDD:276809
TPR repeat 307..334 CDD:276809
TPR_11 339..402 CDD:290150 6/13 (46%)
TPR repeat 339..369 CDD:276809
TPR_1 340..373 CDD:278916
TPR repeat 374..402 CDD:276809 6/13 (46%)
JmjC 870..978 CDD:202224
TOMM34NP_006800.2 TPR 1 9..42 6/18 (33%)
TPR repeat 9..37 CDD:276809 6/13 (46%)
PLN03088 <12..>294 CDD:330826 60/295 (20%)
TPR repeat 50..80 CDD:276809 7/29 (24%)
TPR 2 51..84 7/32 (22%)
TPR repeat 85..113 CDD:276809 7/28 (25%)
TPR 3 86..118 7/32 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..189 3/39 (8%)
TPR 4 193..226 10/37 (27%)
TPR repeat 193..221 CDD:276809 8/32 (25%)
TPR repeat 226..256 CDD:276809 6/32 (19%)
TPR 5 227..260 8/35 (23%)
TPR repeat 261..289 CDD:276809 7/32 (22%)
TPR 6 262..294 8/35 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.