DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trk and NOG

DIOPT Version :9

Sequence 1:NP_476767.2 Gene:trk / 34376 FlyBaseID:FBgn0003751 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_005441.1 Gene:NOG / 9241 HGNCID:7866 Length:232 Species:Homo sapiens


Alignment Length:173 Identity:44/173 - (25%)
Similarity:66/173 - (38%) Gaps:49/173 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELSTQSLAKILGQAFNPRYMSIDPP-----------GEPEEKSY--HLGYKRSSYELPFYADSDA 89
            :|:...|..:||..::|.:|:..||           |..|:.:.  .|..:|.|..:|       
Human    60 DLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMP------- 117

  Fly    90 ISVSHFPAWETNHFALVEKKKEAPRSKSLRTRSAFMDRVGHPRIDGFKQRPW-----ECSSKINW 149
               |.....|.:. .|.:.||:. .||.||.                |.:.|     .|.....|
Human   118 ---SEIKGLEFSE-GLAQGKKQR-LSKKLRR----------------KLQMWLWSQTFCPVLYAW 161

  Fly   150 IDLGLNYFPRYIRSIECIA-RKCWY-DHFNCKP-KSFTIKVLR 189
            .|||..::|||::...|.: |.|.. :...||| ||..:.|||
Human   162 NDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trkNP_476767.2 None
NOGNP_005441.1 Noggin 12..232 CDD:399070 44/173 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..96 3/18 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1391421at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.