DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trk and nog2

DIOPT Version :10

Sequence 1:NP_476767.2 Gene:trk / 34376 FlyBaseID:FBgn0003751 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001007476.1 Gene:nog2 / 550019 XenbaseID:XB-GENE-487602 Length:218 Species:Xenopus tropicalis


Alignment Length:158 Identity:40/158 - (25%)
Similarity:64/158 - (40%) Gaps:32/158 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELSTQSLAKILGQAFNPRYMSIDPPGEPEEKSYHLGYKRSSYELPFYADSDAISVSHFPAWETNH 102
            :|..::|.|.||..|:|.:||:..|     .|.::..:.|..::.... |..:.:......||.:
 Frog    58 DLDERTLRKKLGSNFDPNFMSVVLP-----NSVNMSTQDSLTKMKTLG-SVPLELKKLDLSETPY 116

  Fly   103 FALVEKKKEAPRSKSLRTRSAFMDRVGHPRIDGFKQRPWE---CSSKINWIDLGLNYFPRYIRSI 164
            ...:...|:|.|.                    |.|..|.   |.....|.|||:.::||:|:..
 Frog   117 GGRIRMGKKARRK--------------------FLQWLWAYTYCPVMYTWKDLGVRFWPRFIKEG 161

  Fly   165 ECIARK-CWY-DHFNCKP-KSFTIKVLR 189
            .|.:.| |.: :...||| ||.|...||
 Frog   162 HCFSEKSCSFPEGMYCKPIKSVTKTFLR 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trkNP_476767.2 None
nog2NP_001007476.1 Noggin 10..218 CDD:399070 40/158 (25%)

Return to query results.
Submit another query.