DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trk and nog

DIOPT Version :9

Sequence 1:NP_476767.2 Gene:trk / 34376 FlyBaseID:FBgn0003751 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001165369.1 Gene:nog / 493191 XenbaseID:XB-GENE-487724 Length:222 Species:Xenopus tropicalis


Alignment Length:197 Identity:44/197 - (22%)
Similarity:67/197 - (34%) Gaps:70/197 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELSTQSLAKILGQAFNPRYMSIDPPGEPEEKSYHLGY-----------KRSSYELP-------FY 84
            :|:...|..::...|:|.:|:|:.|.|      .||.           ::.|..:|       ||
 Frog    59 DLNETLLRTLMVGHFDPNFMAINLPEE------RLGVEDLGELDLLLRQKPSGAMPAEIKGLEFY 117

  Fly    85 ADSDAISVSHFPAWETNHFALVEKKKEAPRSKSLRTRSAFMDRVGHPRIDGFKQRPW-----ECS 144
            .                  .|..||...  ||.||.                |.:.|     .|.
 Frog   118 E------------------GLQGKKHRL--SKKLRR----------------KLQMWLWSQTFCP 146

  Fly   145 SKINWIDLGLNYFPRYIRSIECIA-RKCWY-DHFNCK-PKSFTIKVLRRKTGSCIRINDKLILIT 206
            ....|.|||..::|||::...|.: |.|.. :...|| .||..:.:||.:...  |:..|...||
 Frog   147 VLYTWNDLGTRFWPRYVKVGSCYSKRSCSVPEGMVCKAAKSMHLTILRWRCQR--RVQQKCAWIT 209

  Fly   207 AE 208
            .:
 Frog   210 IQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trkNP_476767.2 None
nogNP_001165369.1 Noggin 11..222 CDD:368621 44/197 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1391421at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.