DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trk and nog1

DIOPT Version :9

Sequence 1:NP_476767.2 Gene:trk / 34376 FlyBaseID:FBgn0003751 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_571058.2 Gene:nog1 / 30174 ZFINID:ZDB-GENE-991206-8 Length:216 Species:Danio rerio


Alignment Length:158 Identity:40/158 - (25%)
Similarity:62/158 - (39%) Gaps:31/158 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELSTQSLAKILGQAFNPRYMSIDPPGEPEEKSYHLGYKRSSYELPFYADSDAISVSHFPAWETNH 102
            :|:...|...||. |:.|::|:.||.:....:..|..:.....|......|..::.....|    
Zfish    53 DLNETELRSALGD-FDSRFLSVGPPQDRYAGNEDLDEQELQLNLAGMMPKDIKNLDFDAPW---- 112

  Fly   103 FALVEKKKEAPRSKSLRTRSAFMDRVGHPRIDGFKQRPWE---CSSKINWIDLGLNYFPRYIRSI 164
                .||::|  ||.|:.|              .:...|.   |.....|.|||..::||::|:.
Zfish   113 ----GKKRKA--SKKLKRR--------------LQMWLWSYSFCPVLYAWNDLGSRFWPRFVRAG 157

  Fly   165 ECIA-RKCWY-DHFNCKP-KSFTIKVLR 189
            .|.. |.|.. :...||| ||..|.:||
Zfish   158 SCYTKRSCSVPEGMVCKPAKSTHITLLR 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trkNP_476767.2 None
nog1NP_571058.2 Noggin 18..214 CDD:283466 40/158 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1391421at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.