DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4957 and AT2G25830

DIOPT Version :9

Sequence 1:NP_609366.2 Gene:CG4957 / 34374 FlyBaseID:FBgn0032205 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_565610.1 Gene:AT2G25830 / 817125 AraportID:AT2G25830 Length:331 Species:Arabidopsis thaliana


Alignment Length:257 Identity:48/257 - (18%)
Similarity:111/257 - (43%) Gaps:32/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ANIKHTKALKDGARAALFAKISRQIRMAIQEGNSADPAINSLLRTEIERALKQNMPSGTIQNTLN 72
            :.|...|..:|..:|.|:.:|.:::..|:::| ..:|..|:.|.|.:::|.:.::|...::..:.
plant    89 SKIAGRKGAQDSKKAKLYCRIGKEVVSAVKKG-GPNPVSNTTLATILDKAKELDVPKDIVERNIK 152

  Fly    73 KF--KASKVQLKKYRLDIKYKRNVYLICIFYTDNFSGVKMDATPMIKKAGGEFMDVGSLFEDFGL 135
            :.  |..:..::|. .::.....|.::....||..:........::|..||:..|.||:...|  
plant   153 RASEKGQEAFIEKI-YEVYGYGGVSMVVEVLTDKINRSVAAIRSVVKDYGGKMADSGSVMFKF-- 214

  Fly   136 IETRYDTAKLQNESSLEDKATNDAIELGAEEI----EVVDNVD------------GSVNFLCSPV 184
              .|.....::...:.:|:....|::.|||::    ...|:.|            .:.|:   ..
plant   215 --KRVRVVNIKVTEADKDQLLIIALDAGAEDVIEPPTYEDDTDEDREERYYKIVTSNENY---ST 274

  Fly   185 VLTSLSRNLEKAGYTVENSEHIFSPMNVVQLSPEEQKTYDVFVEKLRNLPGLEDIYDNVEQK 246
            :|:.|..  |...:..:|...:. |:..|::..|..:.....::||..|..::.:|  ::||
plant   275 ILSKLRD--EGVNFEPDNGSELL-PLTTVEVDDEAMELNKELMQKLLELDDVDAVY--IDQK 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4957NP_609366.2 Transcrip_reg 6..243 CDD:279972 46/252 (18%)
AT2G25830NP_565610.1 Transcrip_reg 89..327 CDD:376598 45/249 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0217
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H39079
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62540
OrthoDB 1 1.010 - - D1199273at2759
OrthoFinder 1 1.000 - - FOG0002606
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101960
Panther 1 1.100 - - LDO PTHR12532
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.790

Return to query results.
Submit another query.