DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4957 and Taco1

DIOPT Version :9

Sequence 1:NP_609366.2 Gene:CG4957 / 34374 FlyBaseID:FBgn0032205 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_081622.1 Gene:Taco1 / 70207 MGIID:1917457 Length:294 Species:Mus musculus


Alignment Length:268 Identity:71/268 - (26%)
Similarity:118/268 - (44%) Gaps:53/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AGHSKWANIKHTKALKDGARAALFAKISRQIRMAIQEGNSADPAINSLLRTEIERALKQNMPSGT 66
            |||:||:.::|.|..||..|:.:|:|::..||:|::|| ..:|..||.|...:|....:|||..|
Mouse    55 AGHNKWSKVRHIKGPKDMERSRIFSKLTLSIRLAVKEG-GPNPENNSSLANILELCRSKNMPKST 118

  Fly    67 IQNTLNKFKASKVQL---------------------KKYRLDIKYKRNVYLICIFYTDNFSGVKM 110
            |::.|...|...:.|                     .|..|||||                    
Mouse   119 IESALKTEKNKGIYLLYEGRGPGGSSLLIEALSNSGPKCHLDIKY-------------------- 163

  Fly   111 DATPMIKKAGGEFMDVGS--LFEDFGLIETRYDTAKLQNESSLEDKATNDAIELGAEEI-EVVDN 172
                ::.|.|| .|..|:  .|:..|::....:..: :...:|| :|...|||.|||:: |..|.
Mouse   164 ----ILNKNGG-MMAEGARHFFDKKGVVVVGVEDRE-KKAVNLE-RALELAIEAGAEDVKEAEDE 221

  Fly   173 VDGSV-NFLCSPVVLTSLSRNLEKAGYTVENSEHIFSPMNVVQLSPEEQKTYDVFVEKLRNLPGL 236
            .:.:: .|:|....|..:.:.|:..|....:....|.|.:.|||:..|.:.....::.|.|...:
Mouse   222 EEKNLFKFICDASSLHQVRKKLDSLGLCPVSCSMEFIPHSKVQLAEPELEQAAHLIQALNNYEDV 286

  Fly   237 EDIYDNVE 244
            ..:|||:|
Mouse   287 IHVYDNIE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4957NP_609366.2 Transcrip_reg 6..243 CDD:279972 66/261 (25%)
Taco1NP_081622.1 Transcrip_reg 58..293 CDD:396325 66/262 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850402
Domainoid 1 1.000 74 1.000 Domainoid score I9167
eggNOG 1 0.900 - - E1_COG0217
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H39079
Inparanoid 1 1.050 82 1.000 Inparanoid score I5184
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62540
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002606
OrthoInspector 1 1.000 - - oto95202
orthoMCL 1 0.900 - - OOG6_101960
Panther 1 1.100 - - LDO PTHR12532
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.