DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4957 and TACO1

DIOPT Version :9

Sequence 1:NP_609366.2 Gene:CG4957 / 34374 FlyBaseID:FBgn0032205 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_057444.2 Gene:TACO1 / 51204 HGNCID:24316 Length:297 Species:Homo sapiens


Alignment Length:262 Identity:72/262 - (27%)
Similarity:120/262 - (45%) Gaps:41/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AGHSKWANIKHTKALKDGARAALFAKISRQIRMAIQEGNSADPAINSLLRTEIERALKQNMPSGT 66
            |||:||:.::|.|..||..|:.:|:|:...||:|::|| ..:|..||.|...:|....::||..|
Human    58 AGHNKWSKVRHIKGPKDVERSRIFSKLCLNIRLAVKEG-GPNPEHNSNLANILEVCRSKHMPKST 121

  Fly    67 IQNTLNKFKASKVQLKKYRLDIKYKRNVYLICIFYTDNFSG---------------VKMDATPMI 116
            |:..| |.:.||              :.||:   |.....|               .:.|...::
Human   122 IETAL-KMEKSK--------------DTYLL---YEGRGPGGSSLLIEALSNSSHKCQADIRHIL 168

  Fly   117 KKAGGEFMDVGS--LFEDFGLIETRYDTAKLQNESSLEDKATNDAIELGAEEI-EVVDNVDGSV- 177
            .|.|| .|.||:  .|:..|:|....:..: :...:|| :|...|||.|||:: |..|..:.:| 
Human   169 NKNGG-VMAVGARHSFDKKGVIVVEVEDRE-KKAVNLE-RALEMAIEAGAEDVKETEDEEERNVF 230

  Fly   178 NFLCSPVVLTSLSRNLEKAGYTVENSEHIFSPMNVVQLSPEEQKTYDVFVEKLRNLPGLEDIYDN 242
            .|:|....|..:.:.|:..|....:....|.|.:.|||:..:.:.....::.|.|...:..:|||
Human   231 KFICDASSLHQVRKKLDSLGLCSVSCALEFIPNSKVQLAEPDLEQAAHLIQALSNHEDVIHVYDN 295

  Fly   243 VE 244
            :|
Human   296 IE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4957NP_609366.2 Transcrip_reg 6..243 CDD:279972 67/255 (26%)
TACO1NP_057444.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..45
Transcrip_reg 61..296 CDD:307710 67/256 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160033
Domainoid 1 1.000 71 1.000 Domainoid score I9517
eggNOG 1 0.900 - - E1_COG0217
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H39079
Inparanoid 1 1.050 79 1.000 Inparanoid score I5244
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62540
OrthoDB 1 1.010 - - D1199273at2759
OrthoFinder 1 1.000 - - FOG0002606
OrthoInspector 1 1.000 - - oto91620
orthoMCL 1 0.900 - - OOG6_101960
Panther 1 1.100 - - LDO PTHR12532
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.