DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4957 and taco-1

DIOPT Version :9

Sequence 1:NP_609366.2 Gene:CG4957 / 34374 FlyBaseID:FBgn0032205 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_497183.1 Gene:taco-1 / 175191 WormBaseID:WBGene00021757 Length:285 Species:Caenorhabditis elegans


Alignment Length:255 Identity:72/255 - (28%)
Similarity:118/255 - (46%) Gaps:29/255 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GHSKWANIKHTKALKDGARAALFAKISRQIRMAIQEGNSADPAINSLLRTEIERALK-QNMPSGT 66
            |||||.|||..|...|..|:.....:.|::|.|:..| ..|..:|..| .::|...: |.:|..|
 Worm    42 GHSKWQNIKAVKGKNDLIRSKATNFLLRKVRGAVSRG-GFDMKLNREL-ADLESEFRAQGLPLDT 104

  Fly    67 IQNTLNKFKASKVQLKKYRLDIKYKRNVYLICIFYTDNFSGVKMDATPMIKKAGGEFM----DVG 127
            ::|.|.|.| .|.:: :|..||.....::||....|.|....:.|......|.||..:    .|.
 Worm   105 LKNFLQKMK-DKPEV-EYSFDIIGPSGIFLIVTAETSNKKAFENDLRKYFNKLGGFRLAADGGVR 167

  Fly   128 SLFEDFGLIETRYDT---AKLQNESSLEDKATNDAIELGAEEIEVVDNVDGSVNF--LCSPVVLT 187
            |.||:.|::..  ||   .|:.|...:|:    ..:|..|||:.:::. |.:..|  :|....|.
 Worm   168 SWFEEKGVVHV--DTKKGGKILNIEEMEE----IGLEFDAEEVLLIEE-DSTKKFELICDAKSLQ 225

  Fly   188 SLSRNLEKAGYTVENSEHIFSPMNVVQL----SPEEQKTYDVFVEKLRNLPGLEDIYDNV 243
            :|...|.|.|:::..||..|.|::.:..    .|:.||.|::..|..:    :..|:||:
 Worm   226 TLENGLGKGGFSILQSEIEFRPVHPIDCPEAEEPKVQKLYEMLQEDEQ----VRQIFDNI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4957NP_609366.2 Transcrip_reg 6..243 CDD:279972 68/250 (27%)
taco-1NP_497183.1 Transcrip_reg 45..281 CDD:279972 68/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167551
Domainoid 1 1.000 71 1.000 Domainoid score I6173
eggNOG 1 0.900 - - E1_COG0217
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H39079
Inparanoid 1 1.050 76 1.000 Inparanoid score I3851
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62540
OrthoDB 1 1.010 - - D1199273at2759
OrthoFinder 1 1.000 - - FOG0002606
OrthoInspector 1 1.000 - - oto17225
orthoMCL 1 0.900 - - OOG6_101960
Panther 1 1.100 - - LDO PTHR12532
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.