DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REPTOR-BP and borcs5

DIOPT Version :9

Sequence 1:NP_609363.1 Gene:REPTOR-BP / 34371 FlyBaseID:FBgn0032202 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001007053.1 Gene:borcs5 / 449650 ZFINID:ZDB-GENE-041010-83 Length:207 Species:Danio rerio


Alignment Length:74 Identity:18/74 - (24%)
Similarity:31/74 - (41%) Gaps:19/74 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DMKAKLERSRQSARECRA-------RKKLRYQYLEELVADREKAVVALRTE---------LERLI 90
            |..|.::|.::......|       |:|...:|.|::....|.:::..|.:         :||| 
Zfish   110 DQNALVKRIKEMDLSVEALFSIMQERQKRYAKYAEQIQKVNEMSMILRRIQMGIDQTVPLMERL- 173

  Fly    91 QWNNQLSES 99
              ||.|.||
Zfish   174 --NNMLPES 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
REPTOR-BPNP_609363.1 bZIP_CREBL2 42..97 CDD:269857 15/70 (21%)
coiled coil 43..94 CDD:269857 12/66 (18%)
borcs5NP_001007053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
LOH1CR12 61..179 CDD:287167 16/71 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.