DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REPTOR-BP and crebl2

DIOPT Version :9

Sequence 1:NP_609363.1 Gene:REPTOR-BP / 34371 FlyBaseID:FBgn0032202 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001002702.2 Gene:crebl2 / 436975 ZFINID:ZDB-GENE-040718-456 Length:119 Species:Danio rerio


Alignment Length:109 Identity:55/109 - (50%)
Similarity:69/109 - (63%) Gaps:17/109 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADMEIQSNKMSITEETQVQTRKECGKRGRKPGRKTSTEKLDMKAKLERSRQSARECRARKKLRY 65
            |.|.:|.:.|:           |:.|||||||.      |:|:||||||||||||||||||||||
Zfish     1 MDDSKIVAGKV-----------KKPGKRGRKPA------KIDLKAKLERSRQSARECRARKKLRY 48

  Fly    66 QYLEELVADREKAVVALRTELERLIQWNNQLSESNTPTNNDQLL 109
            |||||||:.:|:|:.|||.||:...||...:.:...|:....||
Zfish    49 QYLEELVSSKERAICALREELDMYKQWCLAMDQGKIPSEIKALL 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
REPTOR-BPNP_609363.1 bZIP_CREBL2 42..97 CDD:269857 39/54 (72%)
coiled coil 43..94 CDD:269857 38/50 (76%)
crebl2NP_001002702.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 12/38 (32%)
bZIP_CREBL2 25..80 CDD:269857 39/54 (72%)
coiled coil 26..77 CDD:269857 38/50 (76%)
Basic motif. /evidence=ECO:0000250 29..60 27/30 (90%)
Leucine-zipper. /evidence=ECO:0000250 62..69 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..119
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589292
Domainoid 1 1.000 73 1.000 Domainoid score I9219
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1003
Inparanoid 1 1.050 97 1.000 Inparanoid score I5031
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551209at2759
OrthoFinder 1 1.000 - - FOG0007856
OrthoInspector 1 1.000 - - oto39896
orthoMCL 1 0.900 - - OOG6_108534
Panther 1 1.100 - - LDO PTHR21051
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5183
SonicParanoid 1 1.000 - - X5809
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.930

Return to query results.
Submit another query.