Sequence 1: | NP_609363.1 | Gene: | REPTOR-BP / 34371 | FlyBaseID: | FBgn0032202 | Length: | 118 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_808355.1 | Gene: | Crebl2 / 232430 | MGIID: | 1889385 | Length: | 123 | Species: | Mus musculus |
Alignment Length: | 109 | Identity: | 56/109 - (51%) |
---|---|---|---|
Similarity: | 68/109 - (62%) | Gaps: | 17/109 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MADMEIQSNKMSITEETQVQTRKECGKRGRKPGRKTSTEKLDMKAKLERSRQSARECRARKKLRY 65
Fly 66 QYLEELVADREKAVVALRTELERLIQWNNQLSESNTPTNNDQLL 109 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
REPTOR-BP | NP_609363.1 | bZIP_CREBL2 | 42..97 | CDD:269857 | 41/54 (76%) |
coiled coil | 43..94 | CDD:269857 | 40/50 (80%) | ||
Crebl2 | NP_808355.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..24 | 11/39 (28%) | |
bZIP_CREBL2 | 25..80 | CDD:269857 | 41/54 (76%) | ||
coiled coil | 26..77 | CDD:269857 | 40/50 (80%) | ||
Basic motif. /evidence=ECO:0000250 | 29..60 | 28/30 (93%) | |||
Leucine-zipper. /evidence=ECO:0000250 | 62..69 | 3/6 (50%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 92..123 | 1/1 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844382 | |
Domainoid | 1 | 1.000 | 75 | 1.000 | Domainoid score | I9057 |
eggNOG | 1 | 0.900 | - | - | E1_KOG4515 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 1 | 1.000 | - | - | H1003 | |
Inparanoid | 1 | 1.050 | 99 | 1.000 | Inparanoid score | I4992 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0007856 | |
OrthoInspector | 1 | 1.000 | - | - | oto93381 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_108534 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR21051 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5183 |
SonicParanoid | 1 | 1.000 | - | - | X5809 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
14 | 13.780 |