DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REPTOR-BP and sam-4

DIOPT Version :9

Sequence 1:NP_609363.1 Gene:REPTOR-BP / 34371 FlyBaseID:FBgn0032202 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001367525.1 Gene:sam-4 / 173955 WormBaseID:WBGene00019126 Length:240 Species:Caenorhabditis elegans


Alignment Length:104 Identity:22/104 - (21%)
Similarity:40/104 - (38%) Gaps:13/104 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ITEETQVQTRKECGKRGRKPGRKTSTEKLDMKAKLERSRQSARECRARKKLRYQYLEEL--VADR 75
            :.|...|..:.....:.:.|....|.|     ||:.|   ...|.||.|:....::..|  :...
 Worm   103 LQEHFAVNAKAVAADQAKIPATCKSVE-----AKMIR---LIEETRAHKEQHDGFMAALSGLNQL 159

  Fly    76 EKAVVALRTELERLIQWNNQLSESNTPTNNDQLLQELGI 114
            ...:.:::..||.::.....|:|..||   |:.|..|.:
 Worm   160 HDDICSIQIILEDIVPMVETLNEILTP---DERLPPLNL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
REPTOR-BPNP_609363.1 bZIP_CREBL2 42..97 CDD:269857 10/56 (18%)
coiled coil 43..94 CDD:269857 10/52 (19%)
sam-4NP_001367525.1 LOH1CR12 64..195 CDD:287167 22/102 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.