DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REPTOR-BP and CREBL2

DIOPT Version :9

Sequence 1:NP_609363.1 Gene:REPTOR-BP / 34371 FlyBaseID:FBgn0032202 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001301.1 Gene:CREBL2 / 1389 HGNCID:2350 Length:120 Species:Homo sapiens


Alignment Length:109 Identity:56/109 - (51%)
Similarity:68/109 - (62%) Gaps:17/109 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADMEIQSNKMSITEETQVQTRKECGKRGRKPGRKTSTEKLDMKAKLERSRQSARECRARKKLRY 65
            |.|.::...|:           |:.|||||||.      |:|:||||||||||||||||||||||
Human     1 MDDSKVVGGKV-----------KKPGKRGRKPA------KIDLKAKLERSRQSARECRARKKLRY 48

  Fly    66 QYLEELVADREKAVVALRTELERLIQWNNQLSESNTPTNNDQLL 109
            |||||||:.||:|:.|||.|||...||...:.:...|:....||
Human    49 QYLEELVSSRERAICALREELEMYKQWCMAMDQGKIPSEIKALL 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
REPTOR-BPNP_609363.1 bZIP_CREBL2 42..97 CDD:269857 41/54 (76%)
coiled coil 43..94 CDD:269857 40/50 (80%)
CREBL2NP_001301.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 11/39 (28%)
bZIP_CREBL2 25..80 CDD:269857 41/54 (76%)
coiled coil 26..77 CDD:269857 40/50 (80%)
Basic motif. /evidence=ECO:0000250 29..60 28/30 (93%)
Leucine-zipper. /evidence=ECO:0000250 62..69 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..120 56/109 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154137
Domainoid 1 1.000 75 1.000 Domainoid score I9100
eggNOG 1 0.900 - - E1_KOG4515
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1003
Inparanoid 1 1.050 100 1.000 Inparanoid score I5006
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551209at2759
OrthoFinder 1 1.000 - - FOG0007856
OrthoInspector 1 1.000 - - oto89810
orthoMCL 1 0.900 - - OOG6_108534
Panther 1 1.100 - - LDO PTHR21051
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5183
SonicParanoid 1 1.000 - - X5809
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.