DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and RNA15

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_011471.1 Gene:RNA15 / 852838 SGDID:S000003012 Length:296 Species:Saccharomyces cerevisiae


Alignment Length:129 Identity:26/129 - (20%)
Similarity:56/129 - (43%) Gaps:16/129 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNP-----PGFAFVEFEHRDDAEKACDILNGSEL 71
            ||:|::.....::.:....:..|.:.::.:.|:|     .|:||:||...:.:..|...|||.:|
Yeast    20 VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNGYQL 84

  Fly    72 ------LGSQLRVEISKGRPRQGRRGGPMDRGGRRGDFGRHSITSGGSGGGGFRQRGSSGSSSR 129
                  .|.....:||....:|.::...::     |:...:...:..|.|..|:..|::...|:
Yeast    85 GSRFLKCGYSSNSDISGVSQQQQQQYNNIN-----GNNNNNGNNNNNSNGPDFQNSGNANFLSQ 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 18/80 (23%)
RNA15NP_011471.1 RRM_CSTF2_RNA15_like 18..94 CDD:409832 17/73 (23%)
CSTF_C 255..291 CDD:405061
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.