DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and GBP2

DIOPT Version :10

Sequence 1:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_009916.1 Gene:GBP2 / 850346 SGDID:S000000517 Length:427 Species:Saccharomyces cerevisiae


Alignment Length:85 Identity:26/85 - (30%)
Similarity:34/85 - (40%) Gaps:9/85 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 QRGSSGSSSRHTERGYSSGRSGASSYNGREGGGSGFNRR--EVYGGGR-------DSSRYSSGSS 175
            :|..|....|:.:...||..:|..|...|...||.||.|  :.|||.|       ...|...|..
Yeast    20 RRRLSDDRDRYDDYNDSSSNNGNGSRRQRRDRGSRFNDRYDQSYGGSRYHDDRNWPPRRGGRGRG 84

  Fly   176 ASYGRTGGQSAGRFRSRSPV 195
            .|....||:..||.|:..|:
Yeast    85 GSRSFRGGRGGGRGRTLGPI 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808
GBP2NP_009916.1 RRM1_HRB1_GBP2 121..197 CDD:410184
RRM2_HRB1_GBP2 218..292 CDD:410185
RRM3_HRB1_GBP2 347..425 CDD:410186
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.