DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and GR-RBP5

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_177563.1 Gene:GR-RBP5 / 843763 AraportID:AT1G74230 Length:289 Species:Arabidopsis thaliana


Alignment Length:223 Identity:68/223 - (30%)
Similarity:98/223 - (43%) Gaps:34/223 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSMGDQRGTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFN-----PPGFAFVEFEHRDDAE 60
            :.|:.....::::||.::....:..|...|:|||::....|..:     ..|||||.|...::|.
plant    25 LQSIRCMSSSKIFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEAS 89

  Fly    61 KACDILNGSELLGSQLRVEIS--KGRPRQGRR-GGPMDRGGRRGDFGRHSITSGGSGGGGFRQRG 122
            .|.. |:|.:|.|.::||..:  :|....||. |||  .||.....|.:...:||.|||.   .|
plant    90 NAMQ-LDGQDLHGRRIRVNYATERGSGFGGRGFGGP--GGGYGASDGGYGAPAGGYGGGA---GG 148

  Fly   123 SSGSSSRHTERGYSSGRSGASSYNGREGGGSG---FNRREVYGGGRDSSRYSSGSSASYGRTGG- 183
            ..|:||.....|...|..|.|||.|..||..|   ::...|.|||...|.:  |....||..|| 
plant   149 YGGNSSYSGNAGGGGGYGGNSSYGGNAGGYGGNPPYSGNAVGGGGGYGSNF--GGGGGYGVAGGV 211

  Fly   184 -----------QSAG---RFRSRSPVGN 197
                       .:||   :|.|..|:||
plant   212 GGSENFAQGSSTNAGFDDKFESNQPLGN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 22/77 (29%)
GR-RBP5NP_177563.1 RRM_SF 35..109 CDD:302621 22/74 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.