DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and GR-RBP3

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001330940.1 Gene:GR-RBP3 / 836224 AraportID:AT5G61030 Length:309 Species:Arabidopsis thaliana


Alignment Length:247 Identity:72/247 - (29%)
Similarity:92/247 - (37%) Gaps:73/247 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSMGDQRGTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFN-----PPGFAFVEFEHRDDAE 60
            |||      :::::|.:...:.:|.|...|||||::....:..:     ..||.||.|...:.|.
plant    37 MSS------SKLFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGRSRGFGFVTFTSSEAAS 95

  Fly    61 KACDILNGSELLGSQLRVEISKGRPRQGRRGGPMDRGGRRGDFGRHSITSGGSGGGGFRQRGSSG 125
            .|...|:|.:|.|..::|..:..|...|..||    ||..|..|.:    |||||.|....|..|
plant    96 SAIQALDGRDLHGRVVKVNYANDRTSGGGFGG----GGYGGGGGGY----GGSGGYGGGAGGYGG 152

  Fly   126 SSSRHTERGYSSGRSGASSYNGREGGGSGFNRREVYGG--------------------------G 164
            |.      ||..|..|   |.|..|||.|.|....|||                          |
plant   153 SG------GYGGGAGG---YGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGSSGGFG 208

  Fly   165 RDSSRYSSGSSASYGRTG--------------GQSAGRFR-----SRSPVGN 197
            ...:.|..|||||.|..|              |.|.|.|.     ..|||||
plant   209 SSGNTYGEGSSASAGAVGDYNGSSGYGSANTYGSSNGGFAGDSQFGGSPVGN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 20/75 (27%)
GR-RBP3NP_001330940.1 RRM2_NsCP33_like 41..116 CDD:410187 20/74 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.