DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and RSZ22

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001078474.1 Gene:RSZ22 / 829285 AraportID:AT4G31580 Length:200 Species:Arabidopsis thaliana


Alignment Length:185 Identity:73/185 - (39%)
Similarity:90/185 - (48%) Gaps:33/185 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPPGFAFVEFEHRDDAEKACDILNGSELLGS 74
            :|||||||..:|.:.:||.||..:|.:.|||:|..|||:||::||...||..|...|:|.    :
plant     2 SRVYVGNLDPRVTERELEDEFRAFGVVRSVWVARRPPGYAFLDFEDPRDARDAIRALDGK----N 62

  Fly    75 QLRVEISKGRPRQGRRGGPMDRGGRRGDFGRHSITSGGSGGGGFRQRGSSGSSSRHTERGYSSGR 139
            ..|||.|..|   |.|||    |||.||       .||.|||    ||..|.|..   :.|..|.
plant    63 GWRVEQSHNR---GERGG----GGRGGD-------RGGGGGG----RGGRGGSDL---KCYECGE 106

  Fly   140 SGASSYNGREGGGSGFNRREVYGGGRDSSRYSSGSSASYGRTGGQSAGRFRSRSP 194
            :|..:...|..||:|  ||......|...||.  .|.||||.....    |:|||
plant   107 TGHFARECRNRGGTG--RRRSKSRSRTPPRYR--RSPSYGRRSYSP----RARSP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 32/70 (46%)
RSZ22NP_001078474.1 RRM_SRSF3_like 3..71 CDD:409808 33/71 (46%)
zf-CCHC 100..114 CDD:395050 3/13 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3142
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 1 1.000 - - mtm954
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.