DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and PSRP2

DIOPT Version :10

Sequence 1:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_566958.3 Gene:PSRP2 / 824379 AraportID:AT3G52150 Length:253 Species:Arabidopsis thaliana


Alignment Length:73 Identity:30/73 - (41%)
Similarity:40/73 - (54%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNP-----PGFAFVEFEHRDDAEKACDILNGSE 70
            :||||||...|.|:.||..|::.||:.|..::..|     .||.||.|...:|.|.|...||.|.
plant   178 KVYVGNLAKTVTKEMLENLFSEKGKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVALNNSL 242

  Fly    71 LLGSQLRV 78
            |.|.::||
plant   243 LEGQKIRV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808 30/73 (41%)
PSRP2NP_566958.3 RRM1_PSRP2_like 77..156 CDD:410188
RRM2_PSRP2 175..253 CDD:410189 30/73 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.