DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and AT2G21440

DIOPT Version :10

Sequence 1:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_565513.1 Gene:AT2G21440 / 816683 AraportID:AT2G21440 Length:1003 Species:Arabidopsis thaliana


Alignment Length:85 Identity:26/85 - (30%)
Similarity:43/85 - (50%) Gaps:6/85 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNP-----PGFAFVEFEHRDDAEKACDILNGSEL 71
            |.|..|...:....||..|::.|.:...::..|.     .|||||:|..::|..:|.::.|||.:
plant    22 VCVSGLPYSITNAQLEEAFSEVGPVRRCFLVTNKGSDEHRGFAFVKFALQEDVNRAIELKNGSTV 86

  Fly    72 LGSQLRVEISKGRPR-QGRR 90
            .|.::.|:.:..||. |.||
plant    87 GGRRITVKQAAHRPSLQERR 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808 21/74 (28%)
AT2G21440NP_565513.1 RRM1_RBM28_like 21..99 CDD:409847 21/76 (28%)
ELAV_HUD_SF 24..411 CDD:273741 25/83 (30%)
RRM2_RBM28_like 332..408 CDD:409848
RRM3_RBM28_like 561..642 CDD:409849
RRM4_RBM28_like 713..810 CDD:409850
PTZ00121 <813..>968 CDD:173412
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.