DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and cirbpb

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001035411.2 Gene:cirbpb / 678563 ZFINID:ZDB-GENE-030131-5841 Length:206 Species:Danio rerio


Alignment Length:196 Identity:71/196 - (36%)
Similarity:92/196 - (46%) Gaps:29/196 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSMGDQRGTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWI-----AFNPPGFAFVEFEHRDDAE 60
            ||..|     ::::|.|:....:..||..|:|||.:..|.:     .....||.||.||:.:||:
Zfish     1 MSDEG-----KLFIGGLSYDTTEQSLEEAFSKYGTIAKVDVIRDRETDRSRGFGFVTFENPEDAK 60

  Fly    61 KACDILNGSELLGSQLRV-EISKGRPRQGR-RGGPMDRGGRRGDFGRHSITSGGSGGGGFRQRGS 123
            .|...:||.::.|..:|| |..|...|.|. |||  .|||.|| |.|.|...||.|.||.|..||
Zfish    61 DAMAAMNGKQVDGRMIRVDEAGKSGGRSGGFRGG--SRGGGRG-FFRGSRGRGGGGYGGDRSYGS 122

  Fly   124 SGSSSRHTERGYSSGRS--GASSYNGREGGGSGFNRREVYGGGRDSSRYSSGSSASYGRTGGQSA 186
                    :|.:...||  |..||.|.:.|..|..|.  ||||..|  |..|......|:||.|:
Zfish   123 --------DRSFGGDRSYGGDRSYGGGDRGYGGGERS--YGGGDRS--YGGGGGGYSNRSGGYSS 175

  Fly   187 G 187
            |
Zfish   176 G 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 24/76 (32%)
cirbpbNP_001035411.2 RRM <2..>81 CDD:223796 25/83 (30%)
RRM_SF 5..83 CDD:302621 25/82 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.