DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and SRSF3

DIOPT Version :10

Sequence 1:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_003008.1 Gene:SRSF3 / 6428 HGNCID:10785 Length:164 Species:Homo sapiens


Alignment Length:185 Identity:73/185 - (39%)
Similarity:89/185 - (48%) Gaps:37/185 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPPGFAFVEFEHRDDAEKACDILNGSELLGSQ 75
            :||||||.:...|.:||..|..||.|.|||:|.|||||||||||...||..|...|:|..|.|.:
Human    11 KVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCR 75

  Fly    76 LRVEISKGRPRQGRRGGPMDRGGR-RGDFGRHSITSGGSGGGGFRQRGSSGSSSRHTERGYSSGR 139
            :|||:|.|..|...||.|...|.| |.|:.|.|...        |:|     |.|  .|.:|..|
Human    76 VRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPP--------RRR-----SPR--RRSFSRSR 125

  Fly   140 SGASSYNGREGGGSGFNRREVYGGGRDSSRYSSGS-SASYGRTGGQSAGRFRSRS 193
            |.:.|.:         .|||     |..||..:.. |.|:.|:      |.||||
Human   126 SRSLSRD---------RRRE-----RSLSRERNHKPSRSFSRS------RSRSRS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808 38/70 (54%)
SRSF3NP_003008.1 Sufficient for interaction with NXF1 and SRSP. /evidence=ECO:0000269|PubMed:12667464, ECO:0000269|PubMed:17036044, ECO:0000269|PubMed:32440474 1..90 41/78 (53%)
RRM_SRSF3 6..86 CDD:241089 40/74 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..164 35/115 (30%)
2 X approximate repeats, basic 119..164 19/62 (31%)

Return to query results.
Submit another query.