DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and srsf7b

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001025438.1 Gene:srsf7b / 572211 ZFINID:ZDB-GENE-050913-95 Length:178 Species:Danio rerio


Alignment Length:97 Identity:50/97 - (51%)
Similarity:59/97 - (60%) Gaps:1/97 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSMGDQRG-TRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPPGFAFVEFEHRDDAEKACD 64
            ||..|...| |:||||||.....|.:||..|..||.|.|||||.||.||||||||...|||.:..
Zfish     1 MSRFGRHGGETKVYVGNLGTGAGKGELERAFGYYGPLRSVWIARNPAGFAFVEFEDPRDAEDSVR 65

  Fly    65 ILNGSELLGSQLRVEISKGRPRQGRRGGPMDR 96
            .|:|..:.||::|||:|.|.||:.|...|..|
Zfish    66 GLDGKVICGSRVRVELSTGMPRRSRYDHPPSR 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 38/70 (54%)
srsf7bNP_001025438.1 RRM <10..>83 CDD:223796 39/72 (54%)
RRM_SRSF7 12..88 CDD:241090 41/75 (55%)
ZnF_C2HC 105..119 CDD:197667
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.