DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and cirbp

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001017228.1 Gene:cirbp / 549982 XenbaseID:XB-GENE-492781 Length:166 Species:Xenopus tropicalis


Alignment Length:186 Identity:59/186 - (31%)
Similarity:85/186 - (45%) Gaps:42/186 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RVYVGNLTDKVKKDDLEGEFTKYGKLNSVWI-----AFNPPGFAFVEFEHRDDAEKACDILNGSE 70
            :::||.|..:..::.||..|:|||::..|.:     :....||.||.||:.:||:.|...:||..
 Frog     7 KLFVGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMMAMNGKS 71

  Fly    71 LLGSQLRVEISKGRPRQGRRGGPMDRGGRRGDFGRHSITSG-GSGGGGFRQRGSSGSSSRHTERG 134
            :.|.|:||: ..|:....||||  .|||..|  ||.....| |.||||              :||
 Frog    72 VDGRQIRVD-QAGKSSNDRRGG--YRGGSSG--GRGFFRGGRGRGGGG--------------DRG 117

  Fly   135 YSSGRSGASSYNGREGGGSGFNRREVYGGGRDSSRYSSGSSASYGRTGGQSAGRFR 190
            |    .|:|.:..|.||......|:.||             .|:|..|.:|.|.:|
 Frog   118 Y----GGSSRFENRSGGYQSSGSRDYYG-------------RSHGSYGDRSGGSYR 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 25/75 (33%)
cirbpNP_001017228.1 RRM_CIRBP_RBM3 6..85 CDD:409883 26/78 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..166 40/125 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.