DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsf1 and SC35

DIOPT Version :9

Sequence 1:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster


Alignment Length:191 Identity:65/191 - (34%)
Similarity:85/191 - (44%) Gaps:33/191 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VGNLTDKVKKDDLEGEFTKYGKLNSVWI-----AFNPPGFAFVEFEHRDDAEKACDILNGSELLG 73
            |.|||.:...:||...|.:.|::..::|     .....|||||.|..:.|||.|.:.::|..|.|
  Fly    27 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDG 91

  Fly    74 SQLRVEISK-GRPRQGRRGGPMDRGGRRGDFGRHSITSGGSGGGGFRQRGSSGSSSRH-----TE 132
            .:|||:::: |||....|..    .||||        .||.||.|.|:|..|.|..|.     ..
  Fly    92 RELRVQMARYGRPSSPTRSS----SGRRG--------GGGGGGSGGRRRSRSRSPMRRRSRSPRR 144

  Fly   133 RGYSSGRSGASSYNGREGGGSGFNRREVYGGGRDSSRYSSGSSASYGRTGGQSAGRFRSRS 193
            |.||..||..|....|.   |.|:|..|.|..|:.....||..|       .:|.|.||||
  Fly   145 RSYSRSRSPGSHSPERR---SKFSRSPVRGDSRNGIGSGSGGLA-------PAASRSRSRS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 25/72 (35%)
SC35NP_001188794.1 RRM <24..>100 CDD:223796 25/72 (35%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 24/69 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.